SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006477 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006477
Domain Number 1 Region: 234-316
Classification Level Classification E-value
Superfamily Nucleoside diphosphate kinase, NDK 0.000000000707
Family Nucleoside diphosphate kinase, NDK 0.0046
Further Details:      
 
Domain Number 2 Region: 37-126
Classification Level Classification E-value
Superfamily C-terminal domain of adenylylcyclase associated protein 0.00000693
Family C-terminal domain of adenylylcyclase associated protein 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006477   Gene: ENSGGOG00000006622   Transcript: ENSGGOT00000006648
Sequence length 324
Comment pep:known_by_projection chromosome:gorGor3.1:X:47629871:47664949:1 gene:ENSGGOG00000006622 transcript:ENSGGOT00000006648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCFFSKRRKADKESRPENEEERPKQYSWDQREKVDPKDYMFSGLKDETVGRLPGTVAGQ
QFLIQDCENCNIYIFDHSATVTIDDCTNCIIFLGPVKGSVFFRNCRDCKCTLACQQFRVR
DCRKLEVFLCCATQPIIESSSNIKFGCFQWYYPELAFQFKDAGLSIFNNTWSNIHDFTPV
SGELNWSLLPEDAVVQDYVPIPTTEELKAVRVSTEANRSIVPISRGQRQKSSDESCLVVL
FAGDYTIANARKLIDEMVGKGFFLVQTKEVSMKAEDAQRVFREKAPDFLPLLNKGPVIAL
EFNGDGAVEGCQLIVNEIFNGTKV
Download sequence
Identical sequences ENSGGOP00000006477 ENSGGOP00000006477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]