SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006497 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006497
Domain Number 1 Region: 30-139
Classification Level Classification E-value
Superfamily SRCR-like 4.71e-17
Family Scavenger receptor cysteine-rich (SRCR) domain 0.01
Further Details:      
 
Domain Number 2 Region: 271-373
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000000471
Family Scavenger receptor cysteine-rich (SRCR) domain 0.02
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000006497
Domain Number - Region: 165-270
Classification Level Classification E-value
Superfamily SRCR-like 0.000353
Family Hepsin, N-terminal domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006497   Gene: ENSGGOG00000006638   Transcript: ENSGGOT00000006668
Sequence length 495
Comment pep:known_by_projection chromosome:gorGor3.1:11:57839788:57867291:1 gene:ENSGGOG00000006638 transcript:ENSGGOT00000006668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEVYIKDGWHMVC
SQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLATHTPQSSIICYGHLGSFSNCSHS
RNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGS
LGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAARAQDPGEPREHQPLPIQWKIQ
NSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAAL
CDSSSARSSLRWEEVCREQQCGSVNSYRVPDAGDPTSRGLFCPHQKLSQCHELWERNSYC
KKVFVTCQDPNPAGLAAGTVASIILALVLLVVLLVVCGPLAYKKLVKKFRQKKQRQWIGP
TGMNQNMSFHRNHTATVRSHAENPTASHVDNEYSQPPRNSRLSAYPALEGALHRSSTQPD
NSSDSDYDLHGAQRL
Download sequence
Identical sequences G3QUT8
ENSGGOP00000006497 XP_004051346.1.27298 ENSGGOP00000006497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]