SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006499 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006499
Domain Number 1 Region: 102-315,438-548
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 7.25e-94
Family Protein serine/threonine phosphatase 0.00000306
Further Details:      
 
Domain Number 2 Region: 550-603
Classification Level Classification E-value
Superfamily EF-hand 0.000000000378
Family Calmodulin-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006499   Gene: ENSGGOG00000006635   Transcript: ENSGGOT00000006670
Sequence length 632
Comment pep:known_by_projection chromosome:gorGor3.1:4:84504366:84540423:-1 gene:ENSGGOG00000006635 transcript:ENSGGOT00000006670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSGTSTQHHFAFQNAERAFKAAALIQRWYRRYVARLEMRRRCTWSIFQSIEYAGQQDQV
KLHDFFSYLMDHFIPSSHNDRDFLTRIFTEDRFAQDSKMGKCSDYESIEVPDSYTGPRLS
FPLLPDHATALVEAFRLKQQLHARYVLNLLYETKKHLVQLPNINRVSTCYSEEITVCGDL
HGQLDDLIFIFYKNGLPSPERSYVFNGDFVDRGKDSVEILMILFAFMLVYPKEFHLNRGN
HEDHMVNLRYGFTKEVMNKYKIHGKEILRTLQDVFCWLPLATLIDEKVLILHGGVSDITD
LELLDKIERSKIVSTMRCKTRQKSEKQMEEKRKANQKSSAQGPIPWFLPESRSLPSSPLR
LGSYKAQKTSRSSSIPCSGSLDGRELSRQVRSSVELELERCRQQAGLLVTGEKEGPSRSA
SEADSEAGELRKPTQEEWRQVVDILWSDPMAQEGCKANTIRGGGCYFGPDVTQQLLQKYN
LQFLIRSHECKPEGYEFCHNRKVLTIFSASNYYEVGSNRGAYVKLGPALTPHIVQYQANK
VTHTLTMRQFISLDEFRQTWKLFSSHMNIDITDDCICDLARSIDFNKDGHIDINEFLEAF
RLVEKSCPEGNASECPQATNAKDSGCSSPGAH
Download sequence
Identical sequences ENSGGOP00000006499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]