SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006507 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006507
Domain Number 1 Region: 2-202
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.34e-32
Family G proteins 0.0027
Further Details:      
 
Domain Number 2 Region: 380-546
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.26e-24
Family G proteins 0.0089
Further Details:      
 
Domain Number 3 Region: 168-268,310-369
Classification Level Classification E-value
Superfamily EF-hand 5.48e-22
Family Calmodulin-like 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006507   Gene: ENSGGOG00000006643   Transcript: ENSGGOT00000006678
Sequence length 656
Comment pep:known_by_projection chromosome:gorGor3.1:5:51955012:52040618:-1 gene:ENSGGOG00000006643 transcript:ENSGGOT00000006678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPERVPTHIVDYSE
AEQSDEQLHQEISQANVICIVYAVNNKHSIDKVTSRWIPLINERTDKDSRLPLILVGNKS
DLVEYSSMETILPIMNQYTEIETCVECSAKNLKNISELFYYAQKAVLHPTGPLYCPEEKE
MKPACIKALTRIFKISDQDNDGTLNDAELNFFQRICFNTPLAPQALEDVKNVVRKHISDG
VADSGLTLKGFLFLHTLFIQRGRHETTWTVLRRFGYDDDLDLTPEYLFPLLKIPPDCTTE
LNHHAYLFLQSTFDKHDLDRDCALSPDELKDLFKVFPYIPWGPDVNNTVCTNERGWITYQ
GFLSQWTRDKKIDLQKKQTQRNVFRCNVIGVKNCGKSGVLQALLGRNLMRQKKIREDHKS
YYAINTVYVYGQEKYLLLHDISESEFLTEAEIICDVVCLVYDVSNPKSFEYCARIFKQHF
MDSRIPCLIVAAKSDLHEVKQEYSISPTDFCRKHKMPPPQAFTCNTADAPSKDIFVKLTT
MAMYPEDHYRDRLSRDMGHTDRIENLRKIWVFLKTAFHARLRCMCTCNRCTFCICQNFLN
SDLLQSVKNKIFTAVLNRHVTQADLKSSTFWLRASFGATVFAVLGFAMYKALLKQR
Download sequence
Identical sequences ENSGGOP00000006507 ENSGGOP00000006507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]