SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006509 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006509
Domain Number 1 Region: 4-97
Classification Level Classification E-value
Superfamily EF-hand 2.14e-24
Family S100 proteins 0.00000881
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006509   Gene: ENSGGOG00000024101   Transcript: ENSGGOT00000006680
Sequence length 101
Comment pep:known_by_projection chromosome:gorGor3.1:1:132421355:132428823:-1 gene:ENSGGOG00000024101 transcript:ENSGGOT00000006680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLANVFE
KKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ
Download sequence
Identical sequences G3QUU9
XP_004026778.1.27298 ENSGGOP00000006503 ENSGGOP00000006509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]