SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006555 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006555
Domain Number 1 Region: 154-367
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.09e-52
Family DBL homology domain (DH-domain) 0.00008
Further Details:      
 
Domain Number 2 Region: 381-500
Classification Level Classification E-value
Superfamily PH domain-like 2.22e-20
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006555   Gene: ENSGGOG00000006693   Transcript: ENSGGOT00000006727
Sequence length 596
Comment pep:known_by_projection chromosome:gorGor3.1:10:5554016:5600196:1 gene:ENSGGOG00000006693 transcript:ENSGGOT00000006727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPELAAQKQPRPRRRSRRAXXXXXXXXXXQSLYLLFEFSINRCSLRRGSSFTFLTPGPN
WDFTLKRKRREKDDDVVSLSSLDLKEPSNKRVRPLARVTSLANLISPVRNGAVRRFGQTI
QSFTLRGDHRSPASAQKFSSRSTVPTPAKRRSSALWSEMLDITMKESLTTREIRRQEAIY
EMSRGEQDLIEDLKLARKAYHDPMLKLSIMSEEELTHIFGDLDSYIPLHEDLLTRIGEAT
KPDGTVEQIGHILVSWLPRLNAYRGYCSNQLAAKALLDQKKQDPRVQDFLQRCLESPFSR
KLDLWSFLDIPRSRLVKYPLLLKEILKHTPKEHPDVQLLEDAILIIQGVLSDINLKKGES
ECQYYIDKLEYLDEKQRDPRIEASKVLLCHGELRSKSGHKLYIFLFQDILVLTRPVTRNE
RHSYQVYRQPIPVQELVLEDLQDGDVRMGGSFRGAFSNSEKAKNIFRIRFHDPSPGQSHT
LQANDVFHKQQWFNCIRAAIAPFQSAGSPPELQGLPELHEECEGNHPSARKLTAQRRAST
VSSVTQVEVDENAYRCGSGMQMAEDSKSLKTHQTQPGIRRARDKALSGGKRKETLV
Download sequence
Identical sequences ENSGGOP00000006555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]