SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006566 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006566
Domain Number 1 Region: 2-147
Classification Level Classification E-value
Superfamily EF-hand 8.66e-56
Family Calmodulin-like 0.000000648
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006566   Gene: ENSGGOG00000006710   Transcript: ENSGGOT00000006738
Sequence length 149
Comment pep:known_by_projection chromosome:gorGor3.1:10:5671691:5672992:1 gene:ENSGGOG00000006710 transcript:ENSGGOT00000006738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDG
NGTVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDE
EVDEMIRAADTDGDGQVNYEEFVRVLVSK
Download sequence
Identical sequences A0A2I2Z4K8 A0A2I3RIC1 P27482
ENSGGOP00000006566 ENSGGOP00000006566 ENSP00000315299 ENSP00000315299 ENSP00000315299 ENSPTRP00000003821 ENSPTRP00000003821 9598.ENSPTRP00000003821 9606.ENSP00000315299 NP_005176.1.87134 NP_005176.1.92137 XP_003827834.1.60992 XP_003951634.1.37143 XP_004049063.1.27298 gi|4885111|ref|NP_005176.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]