SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006583 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006583
Domain Number 1 Region: 561-649
Classification Level Classification E-value
Superfamily SAND domain-like 3.31e-33
Family SAND domain 0.00000579
Further Details:      
 
Domain Number 2 Region: 717-803
Classification Level Classification E-value
Superfamily HMG-box 3.67e-27
Family HMG-box 0.0000142
Further Details:      
 
Domain Number 3 Region: 663-720
Classification Level Classification E-value
Superfamily HMG-box 0.00000000000000602
Family HMG-box 0.0000593
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006583   Gene: ENSGGOG00000006712   Transcript: ENSGGOT00000006756
Sequence length 844
Comment pep:known_by_projection chromosome:gorGor3.1:2b:119653262:119734646:1 gene:ENSGGOG00000006712 transcript:ENSGGOT00000006756 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMFTEDQGVDDRLLYDIVFKHFKRHKVEISNAIKKTFPFLEGLRDRDLITNKMFEDSQDS
CRNLVPVQRVVYNVLSELEKIFNLPVLEALFSDVNMQEYPDLIHIYKSFENVIHDKLPLQ
ESEEEEREERSGLQLSLEQGTGENSFRSLTWPPSGSPSHAGTTPPENGLSEHPCETEQIN
AKRKDTTSDKDDSLGSQQTNEQCAQKAEPAESCEQVAVQVNNGDAGREMPCPLPCDEESP
EAELHNHGIQINSCSVRLVDIKKEKPFSNSKVECQAQARTHHNQASDIIVISSEDSEGST
DVDEPLEVFISAPRSEPVINNDNSLESNDEKEGQEATCSRPQIVPGHLDILSLTSFLKTF
SESVIGQDHDFSESSEEEAPAEASSGALRSKHGEKAPMTSRSTSTWRIPSRKRRFSSSDF
SDLSNGEELQETCSSSLRRGSGSQPQEPENKKCSCVMCFPKGVPRSQEARTESSQASDMM
DTMDVENNSTLEKHSGKRRKKRRHRSKVNGLQRGRKKDRPRKHLTLNNKVQKKRWQQRGR
KANIRPLKRRRKRGPRIPKDENINFKQSELPVTCGEVKGTLYKERFKQGTSKKCIQSEDK
RWFTPREFEIEGDRGASKNWKLSIRCGGYTLKVLMENKLLPEPPSTRKKRILESHNNTLV
DPCEEHKKKNPDASVKFSEFLKKCSEMWKTIFAKEKGKFEDMAKADKAHYEREMKTYIPP
KGEKKKKFKDPNAPKRPPLAFFLFCSEYRPKIKGEHPGLSIDDVVKKLAGMWNNTAAADK
QFYEKKAAKLKEKYKKDIAAYRAKGMPNSAKKRVVKAEKSKKKREEEEDEEDEQEEENEE
DDDK
Download sequence
Identical sequences ENSGGOP00000006583 ENSGGOP00000006583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]