SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006589 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006589
Domain Number 1 Region: 36-370
Classification Level Classification E-value
Superfamily (Trans)glycosidases 9.48e-118
Family Putative alpha-L-fucosidase, catalytic domain 0.000000533
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006589   Gene: ENSGGOG00000006733   Transcript: ENSGGOT00000006762
Sequence length 466
Comment pep:known_by_projection chromosome:gorGor3.1:1:24654480:24677717:-1 gene:ENSGGOG00000006733 transcript:ENSGGOT00000006762 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAPGMRSRPAGPALLLLLVFLGAAESVRRAQPPRRYTPDWPSLDSRPLPAWFDEAKFGV
FIHWGVFSVPAWGSEWFWWHWQGEGRPQYQRFMRDNYPPGFSYADFGPQFTARFFHPEEW
ADLFQAAGAKYVVLTTKHHEGFTNWPSPVSWNWNSKDVGPHRDLVGELGTALRKRNIRYG
LYHSLLEWFHPLYLLDKKNGFKTQHFVSAKTMPELYDLVNSYKPDLIWSDGEWECPDTYW
NSTNFLSWLYNDSPVKDEVVVNDRWGQNCSCHHGGYYNCEDKFKPQSLPDHKWEMCTSID
KFSWGYRRDMAMSDVTEESEIISELVQTVSLGGNYLLNIGPTKDGLIVPIFQERLLAVGK
WLSINGEAIYASKPWRVQWAKNTTSVWYTSKGSAVYAIFLHWPDNGVLNLESPITTSTTK
ITMLGIQGDLKWSTDPDKGLLISLPQLPPSAVPAEFAWTIKLTGVK
Download sequence
Identical sequences G3QV26
ENSGGOP00000006589 ENSGGOP00000006589 XP_018868217.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]