SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006602 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006602
Domain Number 1 Region: 41-167,275-354,748-997
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 7.85e-118
Family Calcium ATPase, transmembrane domain M 0.001
Further Details:      
 
Domain Number 2 Region: 366-578
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 1.08e-70
Family Metal cation-transporting ATPase, ATP-binding domain N 0.00000000173
Further Details:      
 
Domain Number 3 Region: 566-747
Classification Level Classification E-value
Superfamily HAD-like 3.35e-40
Family Meta-cation ATPase, catalytic domain P 0.00012
Further Details:      
 
Domain Number 4 Region: 166-272
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 3.27e-29
Family Calcium ATPase, transduction domain A 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006602   Gene: ENSGGOG00000006738   Transcript: ENSGGOT00000006775
Sequence length 1006
Comment pep:known_by_projection chromosome:gorGor3.1:1:119460259:119481078:1 gene:ENSGGOG00000006738 transcript:ENSGGOT00000006775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILLQVGRDKYEPAAVSEQGDKKGKKGKKDRDMDELKKEVSMDDHKLSLDELHRKYGTDLS
RGLTSARAAEILARDGPNALTPPPTTPEWIKFCRQLFGGFSMLLWIGAILCFLAYSIQAA
TEEEPQNDNLYLGVVLSAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIRNGEKMSI
NAEEVVVGDLVEVKGGDRIPADLRIISANGCKVDNSSLTGESEPQTRSPDFTNENPLETR
NIAFFSTNCVEGTARGIVVYTGDRTVMGRIATLASGLEGGQTPIAAEIEHFIHIITGVAV
FLGVSFFILSLILEYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMSTSTICSDK
TGTLTQNRMTVAHMWFDNQIHEADTTENQSGVSFDKTSATWLALSRIAGLCNRAVFQANQ
ENLPILKRAVAGDASESALLKCIELCCGSVKEMRERYTKIVEIPFNSTNKYQLSIHKNPN
TSEPRHLLVMKGAPERILDRCSSILLHGKEQPLDEELKDAFQNAYLELGGLGERVLGFCH
LFLPDEQFPEGFQFDTDDVNFPIDNLCFVGLISMIDPPRAAVPDAVGKCRSAGIKVIMVT
GDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVVHGSDLKDMTSEQ
LDDILKYHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIA
GSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLIFIIAN
IPLPLGTVTILCIDLGTDMVPAISLAYEQAESDIMKRQPRNPKTDKLVNERLISMAYGQI
GMIQALGGFFTYFVILAENGFLPLHLLGLRVDWDDRWINDVEDSYGQQWTYEQRKIVEFT
CHTAFFVSIVVVQWADLVICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMGVA
LRMYPLKPTWWFCAFPYSLLIFVYDEVRKLIIRRRPGGWVEKETYY
Download sequence
Identical sequences ENSGGOP00000006602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]