SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006603 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006603
Domain Number 1 Region: 575-681
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.28e-34
Family Nucleotide and nucleoside kinases 0.00000142
Further Details:      
 
Domain Number 2 Region: 447-603
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-32
Family SH3-domain 0.00000393
Further Details:      
 
Domain Number 3 Region: 346-443
Classification Level Classification E-value
Superfamily PDZ domain-like 2.37e-32
Family PDZ domain 0.000017
Further Details:      
 
Domain Number 4 Region: 97-196
Classification Level Classification E-value
Superfamily PDZ domain-like 2.1e-28
Family PDZ domain 0.0000223
Further Details:      
 
Domain Number 5 Region: 199-294
Classification Level Classification E-value
Superfamily PDZ domain-like 4.47e-26
Family PDZ domain 0.0000183
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000006603
Domain Number - Region: 25-50
Classification Level Classification E-value
Superfamily L27 domain 0.000765
Family L27 domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006603   Gene: ENSGGOG00000006737   Transcript: ENSGGOT00000006776
Sequence length 682
Comment pep:known_by_projection chromosome:gorGor3.1:17:7386128:7412421:-1 gene:ENSGGOG00000006737 transcript:ENSGGOT00000006776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQRPRAPRSALWLLAPPLLRWAPPLLTVLHSDLFQALLDILDYYEASLSESQVRRWGRA
QSRLRLLFVSCFPKQANSPPVIVNTDTLEAPGYELQVNGTEGEMEYEEITLERGNSGLGF
SIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEAL
KEAGSIVRLYVMRRKPPAEKVMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEG
GAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVAALKNTYDVVYLKVAKPSNAYLSDSYAP
PDITTSYSQHLDNEISHSSYLGTDYPTAMTPTSPRRYSPVAKDLLGEEDIPREPRRIVIH
RGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAI
ALKNAGQTVTIIAQYKPEEYSRFEAKIHDLREQLMNSSLGSGTASLRSNPKRGFYIRALF
DYDKTKDCGFLSQALSFRFGDVLHVIDASDEEWWQARRVHSDSETDDIGFIPSKRRVERR
EWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYARPIIILGPTKDRANDDLLSEFPD
KFGSCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIEAGQYNSHLYGTSVQSVR
EVAEQGKHCILDVSANAVRRLQ
Download sequence
Identical sequences ENSGGOP00000006603 ENSGGOP00000026082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]