SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006611 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006611
Domain Number 1 Region: 42-269
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.1e-74
Family Lectin leg-like 0.00000000416
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000006611
Domain Number - Region: 279-318
Classification Level Classification E-value
Superfamily HMG-box 0.000247
Family HMG-box 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006611   Gene: ENSGGOG00000006753   Transcript: ENSGGOT00000006784
Sequence length 510
Comment pep:known_by_projection chromosome:gorGor3.1:18:57383928:57417752:-1 gene:ENSGGOG00000006753 transcript:ENSGGOT00000006784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGSRQRGLRARVRPLFCALLLSLSRFVRGDGVGGDPAAALPHRRFEYKYSFKGPHLVQS
DGTVPFWAHAGNAIPSSDQIRVAPSLKSQRGSVWTKTKAAFENWEVEVTFRVTGRGRIGA
DGLAIWYAENQGLEGPVFGSADLWNGVGIFFDSFDNDGKKNNPAIVIIGNNGQIHYDHQN
DGASQALASCQRDFRNKPYPVRAKITYYQKTLTVMINNGFTPDKNDYEFCAKVENMIIPA
QGHFGISAATGGLADDHDVLSFLTFQLTEPGKELPTPDKEISEKEKEKYQEEFEHFQQEL
DKKKEEFQKGHPDLQGQPAEEIFESVGDRELRQVFEGQNRIHLEIKQLNRQLDMILDEQR
RYVSSLTEEISKRGAGMPGQHGQITQQELDTVVKTQHEILRQVNEMKNSMSETVRLVSGM
QHPGSAGGVYETTQHFIDIKEHLHIVKRDIDNLVQRNMPSNEKPKCPELPPFPSCLSTVH
FIIFVVVQTVLFIGYIMYRSQQEAAAKKFF
Download sequence
Identical sequences G3QV47
ENSGGOP00000006611 ENSGGOP00000006611 XP_004059531.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]