SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006613 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006613
Domain Number 1 Region: 2-134
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 5.17e-33
Family Tyrosine-dependent oxidoreductases 0.0013
Further Details:      
 
Domain Number 2 Region: 230-340
Classification Level Classification E-value
Superfamily SCP-like 1.79e-28
Family Sterol carrier protein, SCP 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006613   Gene: ENSGGOG00000006759   Transcript: ENSGGOT00000006786
Sequence length 343
Comment pep:known_by_projection chromosome:gorGor3.1:9:94873694:94941968:1 gene:ENSGGOG00000006759 transcript:ENSGGOT00000006786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLAGCTVFITGASRGIGKAIALKAAKDGANIVIAAKTAQPHPKLLGTIYTAAEEIEAVGG
KALPCIVDVRDEQQISAAVEKAIKKFGGIDILVNNASAISLTNTLDTPTKRLDLMMNVNT
RGTYLIHTAAMDMLGGPGIESQCRKVDIIADAAYSIFQKPKSFTGNFVIDENILKEEGIE
NFDVYAIKPGHPLQPDFFLDEYPEAVSKKVESTGAVPEFKEEKLQLQPKPRSGAVEETFR
IVKDSLSDDVVKATQAIYLFELSGEDGGTWFLDLKSKGGNVGYGEPSDQADVVMSMTTDD
FVKMFSGKLKPTMAFMSGKLKIKGNMALAIKLEKLMNQMNARL
Download sequence
Identical sequences ENSGGOP00000006613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]