SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006680 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006680
Domain Number 1 Region: 294-403
Classification Level Classification E-value
Superfamily E set domains 1.18e-30
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000239
Further Details:      
 
Domain Number 2 Region: 230-294
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.84e-16
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000268
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006680   Gene: ENSGGOG00000006817   Transcript: ENSGGOT00000006853
Sequence length 1381
Comment pep:known_by_projection chromosome:gorGor3.1:16:59811660:59896806:1 gene:ENSGGOG00000006817 transcript:ENSGGOT00000006853 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVYDLLPKELQLPPSRETSVASMSQTSGGEAGSPPPAVVAADASSAPSSSSMGGACSSFT
TSSSPTIYSTSVTDSKAMQVESCSSAVGVSNRGVSEKQLTSNTVQQHPSTPKRHTVLYIS
PPPEDLLDNSRMSCQDEGCGLESEQSCSMWMEDSPSNFSNMSTSSYNDNTEVPRKSRKRN
PKQRPGVKRRDCEESNMDIFDADSAKAPHYVLSQLTTDNKGNSKAGNLEGHNEPVVLQVF
VGNDSGRVKPHGFYQACRVTGRNTTPCKEVDIEGTTVIEVGLDPSNNMTLQPAGVPEILK
KSLHSCSVKGEEEVFLIGKNFLKGTKVIFQENVSDENSWKSEAEIDMELFHQNHLIVKVP
PYHDQHITLPVSVGIYVVTNAGRSHDVQPFTYTPDTAAAGALNVNVKKEISSPARPCSFE
EAMKAMKTTGCNLDKVNIIPNALITPLIPSSMIKSEDVTPMEVTAEKRSSTIFKTTKSVG
STQQTLENISNIAGNGSFSSPSSSHLPSENEKQQQIQPKAYNPETLTTIQTQDISQPGTF
PAVSASSQLPNSDALLQQATQFQTRETQSREVLQSDGTVVNLSQLTEASQQQQQSPLQEQ
AQTLQQQISSNIFPSPNSVSQLQNTIQHLQAGSFTGSTASGSSGSVDLVQQVLEAQQQLS
SVLFSAPDGNENVQEQLSADIFQQVSQIQSGVSPGMFSSTEPTVHTRPDNLLPGRAESVH
PQSENTLSNQQQQQQQQQVMESSAAMVMEMQQSICQAAAQIQSELFPSTASANGNLQQSP
VYQQTSHMMSALSTNEDMQMQCELFSSPPAVSGNETSTTTTQQVATPGTTMFQTSSSGDR
EETGTQAKQIQNSVFQTMVQMQHSGDNQPQVNLFSSTKSMMSVQNSGTQQQGNGLFQQGN
EMMSLQSGNFLQQSSHSQAQLFHPQNPIADAQNLSQETQGSLFHSPNPIVHSQTSTTSSE
QMQPPMFHSQSTIAVLQGSSVPQDQQSTNIFLSQSPMNNLQTNTVAQEAFFAAPNSISPL
QSTSNSEQQAAFQQQAPISHIQTPMLSQEQAQPPQQGLFQPQVALGSLPPNPMPQSQQGT
MFQSQHSIVAMQSNSPSQEQQQQQQQQQQQQQQQQQSILFGNQNTMATMASPKQPPPNMI
FNPNQNPMANQEQQNQSIFHQQSNMAPMNQEQQPMQFQSQSTVSSLQNPGPTQSESSQTP
LFHSSPQIQLVQGSPSPQEQQVTLFLSPASMSALQTSINQQDMQQSPLYSPQNNMPGIQG
ATSSPQSQATLFHNTAGGTMNQLQNSPGSSQQTSGMFLFGIQNNCSQLLTSGPATLPDQL
MAISQPGQPQNEGQPPVTTLLSQQMPENSPLASSINTNQNIEKIDLLVSLQNQGNNLTGS
F
Download sequence
Identical sequences ENSGGOP00000006680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]