SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006693 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006693
Domain Number 1 Region: 95-422
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 4.78e-68
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000000075
Further Details:      
 
Domain Number 2 Region: 426-554
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.14e-40
Family Ricin B-like 0.000000358
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006693   Gene: ENSGGOG00000006840   Transcript: ENSGGOT00000006866
Sequence length 560
Comment pep:known_by_projection chromosome:gorGor3.1:18:32952256:33010006:1 gene:ENSGGOG00000006840 transcript:ENSGGOT00000006866 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKFAYCKVVLATSLIWVLLDMFLLLYFSECNKCDEKKERGLPAGDVLEPVQKPHEGPGE
MGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSV
VIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKVPVHV
IRMEQRSGLIRARLKGAAVSKGQVITFLDAHCECTVGWLEPLLARIKHDRRTVVCPIIDV
ISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDR
DYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQ
IINKNNRRLAEVWMDEFKNFFYIISPAGVTKVDYGDISSRVGLRHKLQCKPFSWYLENIY
PDSQIPRHYFSLGEIRNVETNQCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTD
DLCLDVSKLNGPVTMLKCHHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRD
CNGSRSQQWLLRNVTLPEIF
Download sequence
Identical sequences ENSGGOP00000006693 ENSGGOP00000006693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]