SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006696 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006696
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.71e-21
Family THAP domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006696   Gene: ENSGGOG00000006842   Transcript: ENSGGOT00000006869
Sequence length 239
Comment pep:known_by_projection chromosome:gorGor3.1:1:6701867:6710643:1 gene:ENSGGOG00000006842 transcript:ENSGGOT00000006869 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKSCAARQCCNRYSSRRKQLTFHRFPFSRPELLKAWVLNIGRGNFKPKQHTVICSEHFR
PECFSAFGNRKNLKHNAVPTVFAFQDPTQQVRENTDPASERGNASSSQKEKVLPEAGAGE
DSPGRNMDTALEELQLPPNAEGHVKQVSPRRPQATEAVGRLTGPAGLRTPPNKQPSDHSY
ALLDLDSLKKKLFLTLKENEKLRKRLQAQRLVMRRMSSRLRACKGHQGLQARLGPEQQS
Download sequence
Identical sequences G3QVD1
ENSGGOP00000006696 XP_004024618.1.27298 ENSGGOP00000006696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]