SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006701 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006701
Domain Number 1 Region: 279-407
Classification Level Classification E-value
Superfamily SH2 domain 8.89e-22
Family SH2 domain 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006701   Gene: ENSGGOG00000006844   Transcript: ENSGGOT00000006875
Sequence length 428
Comment pep:known_by_projection chromosome:gorGor3.1:4:10270718:10457568:-1 gene:ENSGGOG00000006844 transcript:ENSGGOT00000006875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRQGNRRTTKEGSNDLKFQNFSLPKNRSWPHINSATGQYQRMNKPLLDWERNFAAVLDG
TKGHSDDDYDDPELRKEETWQPIKILPARPIKESEYADTRYFKVAMDTPLPLDTRTSIST
GQQTWNTQTRLERVDKPISKDIRSQNIKGDTSVRKNKIPLPPPRPLITLPKKYQPLPPEP
ESSRPPLSQRHTFSEAQRMPSQISLRDLSEVLEAEKVPYNQRKPESTHLLQNQNTQEIPL
AISSSSFTTSNHSVQNRDHRGGMQPCSPQRCQPPASCSPHENILPYKYTSGRPPFPKRSD
RKDVQHNEWYIGEYSRQAVEEAFMKENKDGSFLVRDCSTKSKEEPYVLVVFNENKVYNVK
IRFLERSQQFALGTGLRGDEKFDSVEDIIEHYKNFPIILIDGKDKTGVHRKQCHLTQPLP
LTRHLLPL
Download sequence
Identical sequences G3QVD6
ENSGGOP00000006701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]