SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006736 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006736
Domain Number 1 Region: 269-459
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.75e-53
Family cAMP-binding domain 0.00000000555
Further Details:      
 
Domain Number 2 Region: 30-272
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.31e-30
Family Voltage-gated potassium channels 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006736   Gene: ENSGGOG00000006884   Transcript: ENSGGOT00000006913
Sequence length 612
Comment pep:known_by_projection chromosome:gorGor3.1:19:528350:556990:1 gene:ENSGGOG00000006884 transcript:ENSGGOT00000006913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSLRMFGSQKAVEREQERVKSAGAWIIHPYSDFIIIPVGITFFKDETTALWIVFNVVSDT
FFLMDLVLNFRTGIVIEDNTEIILDPEKIKKKYLRTWFVVDFVSSIPVDYIFLIVEKGID
SEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEASAVMRICNLISMMLLLCHWD
GCLQFLVPMLQDFPRNCWVSINGMVNHSWSELYSFALFKAMSHMLCIGYGRQAPESMTDI
WLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADFRQKIH
DYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLK
FEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTAS
VRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLHKVQHDLNSG
VFNNQENAIIQEIVKYDREMVQQAELGQRVGLFPPPPPPQVTSAIATLQQAVAMSFCPQV
ARPLVGPLALGSPRLVRRPPPGPAPAAASPGPPPPASPPGAPASPRAPRTSPYGSLPAAP
LAGTALPARRLS
Download sequence
Identical sequences ENSGGOP00000006736 ENSGGOP00000006736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]