SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006743 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006743
Domain Number 1 Region: 214-459
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.93e-77
Family Leukotriene A4 hydrolase catalytic domain 0.000000000289
Further Details:      
 
Domain Number 2 Region: 12-208
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 3.53e-53
Family Leukotriene A4 hydrolase N-terminal domain 0.00000000406
Further Details:      
 
Domain Number 3 Region: 462-610
Classification Level Classification E-value
Superfamily ARM repeat 1.78e-46
Family Leukotriene A4 hydrolase C-terminal domain 0.0000000606
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006743   Gene: ENSGGOG00000006881   Transcript: ENSGGOT00000006920
Sequence length 611
Comment pep:known_by_projection chromosome:gorGor3.1:12:95129071:95163996:-1 gene:ENSGGOG00000006881 transcript:ENSGGOT00000006920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEIVDTCSLASPASVCRTKHLHLRCSVDFTRRTLTGTAALTVQSQEDNLRSLVLDTKDL
TIEKVVINGQEVKYALGERQSYKGSPMEISLPIALSKNQEIVIEISFETSPKSSALQWLT
PEQTSGKEHPYLFSQCQAIHCRAILPCQDTPSVKLTYTAEVSVPKELVALMSAIRDGEAP
DPEDPSRKIYKFIQKVPIPCYLIALVVGALESRQIGPRTLVWSEKEQVEKSAYEFSETES
MLKIAEDLGGPYVWGQYDLLVLPPSFPYGGMENPCLTFVTPTLLAGDKSLSNVIAHEISH
SWTGNLVTNKTWDHFWLNEGHTVYLERHICGRLFGEKFRHFNALGGWGELQNSVKTFGET
HPFTKLVVDLTDIDPDVAYSSVPYEKGFALLFYLEQLLGGPEIFLGFLKAYVEKFSYKSI
TTDDWKDFLYSYFKDKVDVLNQVDWNAWLYSPGLPPIKPNYDMTLTNACIALSQRWITAK
EDDLNSFNATDLKDLSSHQLNEFLAQTLQRAPLPLGHIKRMQEVYNFNAINNSEIRFRWL
RLCIQSKWEDAIPLALKMATEQGRMKFTRPLFKDLAAFDKSHDQAVRTYQEHKASMHPVT
AMLVGKDLKVD
Download sequence
Identical sequences G3QVH4
ENSGGOP00000006743 XP_004053757.1.27298 ENSGGOP00000006743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]