SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006765 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006765
Domain Number 1 Region: 247-306
Classification Level Classification E-value
Superfamily RING/U-box 6.1e-19
Family RING finger domain, C3HC4 0.0055
Further Details:      
 
Domain Number 2 Region: 102-135
Classification Level Classification E-value
Superfamily PA domain 0.0000000798
Family PA domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006765   Gene: ENSGGOG00000006918   Transcript: ENSGGOT00000006942
Sequence length 376
Comment pep:known_by_projection chromosome:gorGor3.1:7:120721426:120722556:-1 gene:ENSGGOG00000006918 transcript:ENSGGOT00000006942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHLLKVGTWRNNTASSWLMKFSVLWLVSQNCCRASVVWMAYMNISFHVGNHVLSELGETG
VFGRSSTLKRVAGVIVPPEGKIQNACNPNTIFSRSKYSETWLALIERGDCTFTQKIKVAT
EKGASGVIIYNVPGTGNQVFPMFHQAFEDVVVVMIGNLKGTEIFHLIKKGVLITAVVEVG
RKHIIWMNHYLVSFVIVTTATLAYFIFYHIHRLCLARIQNQRWQRLTTDLQNAFGQLQLR
VVKEGDEEINPSGDSCVICFEHYKPNDIVRILTCKHFFHKNCIDPWILPHGTCPICKCDI
LKVLGIQVVVENGTEPLQVLMSNELPETLSPSEEETNNEVSPAGTSDKVIHVEENPTSQN
NDIQPHSVVEDVHPSP
Download sequence
Identical sequences ENSGGOP00000006765 ENSGGOP00000006765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]