SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006773 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006773
Domain Number 1 Region: 3-185,224-283
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.28e-51
Family Motor proteins 0.0000173
Further Details:      
 
Domain Number 2 Region: 4307-4496
Classification Level Classification E-value
Superfamily Bet v1-like 5.86e-25
Family STAR domain 0.02
Further Details:      
 
Domain Number 3 Region: 343-423
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.000000000000497
Family FHA domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006773   Gene: ENSGGOG00000006926   Transcript: ENSGGOT00000006951
Sequence length 4508
Comment pep:known_by_projection chromosome:gorGor3.1:15:21301651:21434014:1 gene:ENSGGOG00000006926 transcript:ENSGGOT00000006951 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANVQVAVRVRPLSKRETKEGGRIIVEVDGKVAKIRNLKVDNRPDGFGDSREKVMAFGFD
YCYWSVNPEDPQYASQDVLSQHVVTNYKQVIQLLEEGIANRITAATHVHEASSRSHAIFT
IHYTQAILENSLPSEMASKINLVDLAGSERADPSYCKDRIAEGANINKSLVTLGIVISTL
AQNSQVFSSCQSLNSSVSNGDDSGILSSPSGTSSGGAPSRRQSYIPYRDSVLTWLLKDSL
GGNSKTIMVAIARTMSTLRYASSAKNIINKPRVNEVRPFQKNFGSLSDEKDEKLKELVLQ
NELKIDQLTKDWTQKWNDWQALMEHYSVDINRRRAGVVIDSSLPHLMALEDDVLSTGVVL
YHLKGQWIERDHCTITSACGVVVLRPARGARCTVNGREVTASCRLTQGAVITLGKAQKFR
FNHPAEAAVLRQRRQVGEAAACGGSLEWLDLDGDLAVSRLGLSPLLWKERRALEEQCDED
HQPPRDGETSHRAQIQQQQSYVEDLRHQILAEEIRAEKELEFDQAWISQQIKENQQCLLR
EETWLASLQQQQQEDQVAEKELEASVALDAWLQTDPEIQPSPFVQSQKRVVHLQLLRRHT
LRAAERNVRRKKVSFQLERIIKKQRLLEAQKRLEKLTTLCWLQDDSTQEPPYQVLSPDAT
VPRPRCRSKLTSCSSLSPQRLCSKHMPQLHSIFLSWDPSTTLPPRPDPTHQTSEKTSSEE
HLLQAASYPARTGCLRKNGLHSSGHGQPCTARAALSRKGASATDTCLTMSPNSVGIQEME
MGVKQPHQMVSQGLASLRKSANKLKPRHEPKIFTSTTQTRVAKGLADPSHTQAGWRKEGN
LGTHKAAKGASCNSLYPHGPRQTAGHGKAVKTFWTEYKPPSPSRASKRHQRVLATRVRNI
TKKSSHLPLGSPLKRQQNRRDPDTMVPLTDFSPVVDHSREKDNDLSDTDSNYSVDSLSCV
YAKALIEPLKPEERKWDLPEPENSESDDSQLSEDSLAEKRYQSPKNRLGGNRPTNNRGQP
RTRTRASVRGFTAASDSDLLAQTHRSFSLDSLIDAEEELGEDQQEEPFPGSADEIPTETF
WHLDNSSLPVMDQEAICRLGPINYRTAARLDAVLPTSSSFYLDPQFQPHCMQLSRESPLM
SMDSWFSCDSKINPSSTPGIVGSLCPSPDMQEFHPCKGERPGYWPNTEELKPSDAEKVLP
YSSKLHQGSTELLCSARDGHTASAADMSRLSLWGIQRLIQPGADGTFQGRCIPDMTQQGS
SEASHNSSVSNVLAASATTLSHVGSTHERDWSALQQKYLLELSCPVLEAIGAPKPAYPYL
EEDSGSLAQASSKGGDTLLPVGPGVSSNLNLNNFPIHLSRIRRLRAEKEQDSLNAKLEGV
SDFFSTSEKEASYDETYSADLESLSASRSTNAQVFAAENAIPDSMTEACEVKQNLEECLQ
SCRKPGLMTSSDEDFFQKNACHSNVTTATKADHWSQGWAPLRKNSTVQPGQLSPDSHYPL
EEEKTDCQESSKEAVRRHINVSFALPSGPELYLHSAPWNPLSSSLQPPLLETFYVTKSRD
ALTETALEIPACREVRVPSPPPREAWGFGHNHQALQGAYLKNNLPVLLQNQNSKIASSHQ
VTAEIPIDLNTREVIRESGKCPGNITEESHDSVYSSVTQNRHFLPSTSTKVCEFENQVVI
LNKKHSFPALEGGEVTAQSCCSASSDSTESGKSLLLFRESEAREEEELDQNTVLRQTINV
SLEKDMPGESAVSLKSRSVDRRVSSPVMVAQDGGPTPKWEGKNETGLREKGLHPKDSSEE
FKLPGTKPAYERFQLVACPQERNPSECKSQEMLNPNREPSGKKQNKRVNNTDEMARLIRS
VMQLENGILEIESKQNKQVHASHTPGTDKKLVFQDQKEQEKTDHAFRPDSSGNPLPSKDQ
PSSPRQTDDTVFRDSEAGEMEVNSIGNHPQVQKITPNPFRSREGIRESEPVREHTHPAGS
DRPARDIYDSLGKHTTCREFTNTSLHPQRMKALARALPLQPRLERSSKNNGQFVKASASL
KGQPWGLGSLEELETVKGFQESQVAEHVSSSNQEEPKAEGKVEEMPMQRGGSLQEENKVT
QKFPSLSQLCRDTFFSQETVSPLLSRTEFCTAPLHQDLSNTLPLNSPRWPRRCLHVPVAL
GISSLDCVLDLTMLKIHNSPLVTGVEHQDQSTETRSHSPEGNVRGRSSEAHTAWCGSVRS
MAMGSHSQSGVPESIPLGTEDRISASTSPQDHGKDLRITLLGFSTSEDFASEAEVAVQKE
IRVSSLNKVSSQPEKRVSFSLEEDNDQARKPRQKAEKETEDLGLTSGVSLAPVSLPRVPS
PEPRLLEPSDHASMCLAILEEIRQAKAQRKQLHDFVARGTVLSYCETLLEPECSTRVGGR
PQCKQIDQSSSDQTRNEGEAPGFHVASLSAEAGQIDLLPDERKVQATSLSADSFQSLPNT
ETDREPWDPVQAFSHAAPAQDRKHRTGELRQFAGASEPFICHSSSSEIIEKKKDATTTPS
SADPLAPDSPRSSAPVEEVRRVVSKKVVAALSSQAPCDDLRVTLHELSQPVPQETAEGIP
PGSQDGSPEHQEPRTLDTTYGEVSDNLLVTAQGEKTAHFESQSVTCDVQNSTSASGPKQD
HVQCPEASTGFEEGRASPKQDTILPGALTRVELEAPTQQCVQCKESVGSGLTEVCRAGSK
HSRPIPLPDQRPSANLEGIGEGAPCRHPREALDGPVFSRNPEGSRTLSPSRGKESRTLPC
RQPCSSQPVATHAYSSHSSTLLCFRDGGLGKKPFKAAPHTIHPPCVVPSRAYEMDETGEI
SSRGPDVHLTHGLEPKDVNREFRLTESSTCEPSTVAAVLSRAQGCRSPSAPDVRTSSFSH
SATDGSVGLIGVPEKKVAEKQASTELEAASFPAGMYSEPLRQFRDSSVGDQNAQVCQTNP
GPPATTQGPHTLDLSEGSAESKLVAEPQHECLENTTRCFLEKPQFSTELRDHNRLDSQAK
FVARLKHTCSPQEDSPWQEEEQHRDQASGGGEGFAQGVNPLPDEDGLDGCQILVAGREEV
AVAQPPVSKILSQGFKDPATVSLRQNETPQPAAQRPGHLYTGREQPAPNHRGSLPVTTIF
SGPKHSRSSPTPQFSVVSSSRSLQELNLSVEPPSPTDEDTQGPNRLWNPHLRAYSSGKSV
ARTSLQAEDSNQKASSRLDDGTTNHRHLKPATPPYPMPSTLSHMPTPDFTTGWMSGTLEL
AQQGKPEKLGVQVRPENWCSQMDKGMLHFGSSDISPYALPWRLEEPARISWKQYVSGSAV
DVACSQKPQGLTLSNVARCSSMDNGLEDQNSPFHSHLSTYANIRDLSTTHSSTENAQGSN
EAWEVFRGSSSIALGDPHIPTSPEGVAPTLGHDRRPQFRGPSGEADCLRSKPPLAEGGAA
GPVDEIMLLYPSEAGCPVEQTRTNTFEQGTQTLGSRRHWSSTDISFAQPEASAVSAFDLA
SWTSMHNLSLHLSQLLHSTSELLGSLSQPDVARREQNTKRDIPDKAPQALMMDGSTQTTV
DEGSQTDLTLPTLCLQTSEAEPQGANVILEGLGSDTSTVSQEEGDGPGVPQKREAEETAQ
KMAQLLYLQEESTPYKPQSPSIPSSHLRFQKAPLGRHLPSVSPSVSDAFLPPSSQPEESY
CLVVSSPSPSSPHSPGLFPSTSEYPGDSRVQKKLGPTSVLLVDRASSPILTLSASTQEPG
LSPGSLTLLAPSAHPVEGHQKLDSSPDPVGAPRTPVDNYSQTTDELGGSQRGRSSLQRSN
GRSFLELHSPHSPQQSPKLQFSFLRQHPQQLQPRTTIGVQSRLLTPPLRHRNQRLGNSFV
PEKVASPEHCPLSGREPSQWQSRTENGGESSASPGEPQRTLDRPPSWGGLQHLSPCPVSE
LTDTAGLRGSALGLPQACQPEELLCSSCQMCMAPEHQHHSLRDLPVHNKFSNWCGVQKGL
PGGLDMTEEELGASGDLSSEKQEQSPPQPPNDHSQDSEWSKREQIPLQVGAQNLSLSVEL
TEAKLHHGFGEADALLQVLQSGTGEALAADEPVTSTWKELYARQKKAIETLRRERAERLG
NFCRTRSLSPQKQLSLLPNKDLFIWDLDLPSRRREYLQQLRKDVVETTRYPESVSRSAHT
PSDIELMLQDYQQAHEEAKVEIARARDQLRERTEQEKLRIHQQIISQLLKEEDKLHTLAN
SSSLCTSSNGSLSSGMTSGYNSSPALSGQLQFPENMGHTNLPDSRDVWIGDERGGHSAVR
KNSAYSRRASLGSCCCSPSSLSSLGTCFSSSYQDLAKHVVDTSMADVMAACSDNLHNLFS
CQATAGWNYQGEEQAVQLYYKVFSSTRHGFLGAGVVSQPLSHVWAAVSDPTLWPLYYKPI
QTARLHQRVTNSISLVYLVCNTTLCALKQPRDFCCVCVEAKEGHLSVMAAQSVYDTSMPR
PSRKMVRGEILPSAWILQPVTVEGKEVTRVIYLAQVELGAPGFPPQLLSSFIKQQPLVIA
RLASFLGS
Download sequence
Identical sequences ENSGGOP00000006773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]