SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006783 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006783
Domain Number 1 Region: 175-238
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000194
Family LIM domain 0.062
Further Details:      
 
Domain Number 2 Region: 235-302
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000143
Family LIM domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000006783
Domain Number - Region: 298-321
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00357
Family LIM domain 0.022
Further Details:      
 
Domain Number - Region: 138-179
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0806
Family LIM domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006783   Gene: ENSGGOG00000006935   Transcript: ENSGGOT00000006961
Sequence length 857
Comment pep:known_by_projection chromosome:gorGor3.1:3:65662363:65794068:-1 gene:ENSGGOG00000006935 transcript:ENSGGOT00000006961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KICLHCKCPQEEHMVTVMPLEMEKTISKLMFDFQRNSTSDDDSGCALEEYAWVPPGLKPE
QVHQYYSCLPEEKVPYVNSPGEKLRIKQLLHQLPPHDNEVRYCNSLDEEEKRELKLFSSQ
RKRENLGRGNVRPFPVTMTGAICEQCGGQINGGDIAVFASRAGHGVCWHPPCFVCTVCNE
LLVDLIYFYQDGKIYCGRHHAECLKPRCAACDEIIFADECTEAEGRHWHMKHFCCFECET
VLGGQRYIMKEGRPYCCHCFESLYAEYCDTCAQHIGIDQGQMTYDGQHWHATETCFCCAH
CKKSLLGRPFLPKQGQIFCSRACSAGEDPNGSDSSDSAFQNARAKESRRSAKIGKNKGKT
EEPMLNQHSQLQVSSNRLSADVDPLSLQMDMLSLSSQTPSLNRDPIWRSREEPYHYGNKM
EQNQTQSPLQLLSQCNIRTSYSPGGQGAGAQPEMWGKHFSNPKRSSSLAMTGHAGSFIKE
CREDYYPGRLRSQESYSDMSSQSFSETRGSIQVPKYEEEEEEEGGMSTQQCRTRHPISSL
KYTEDMTPTEQTPRGSMESLALSNATGLSADGGAKRQEHLSRFSMPDLSKDSGMNVSEKL
SNMGTLNSSMQFRSAESVRSLLSAQQYQEMEGNLHQLSNPIGYRDLQSHGRMHQSFDFDG
GMAGSKLPGQEGVRIQPMSERTRRRATSRDDNRRFRPHRSRRSRRSRSDNALHLASEREA
ISRLKDRPPLRAREDYDQFMRQRSFQESMGHGSRRDLYGQCPRTVSDLALQNAFGDRWGP
YFAEYDWCSTCSSSSESDNEGYFLGEPIPQPARLRYVTSDELLHKYSSYGLPKSSTLGGR
GQLHSRKRQKSKNCIIS
Download sequence
Identical sequences ENSGGOP00000006783 ENSGGOP00000006783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]