SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006784 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006784
Domain Number 1 Region: 267-396
Classification Level Classification E-value
Superfamily Second domain of FERM 3.93e-31
Family Second domain of FERM 0.0018
Further Details:      
 
Domain Number 2 Region: 398-503
Classification Level Classification E-value
Superfamily PH domain-like 4.06e-23
Family Third domain of FERM 0.0069
Further Details:      
 
Domain Number 3 Region: 43-138
Classification Level Classification E-value
Superfamily PDZ domain-like 5.06e-16
Family PDZ domain 0.027
Further Details:      
 
Domain Number 4 Region: 180-261
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000241
Family Ras-binding domain, RBD 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006784   Gene: ENSGGOG00000006929   Transcript: ENSGGOT00000006962
Sequence length 1578
Comment pep:known_by_projection chromosome:gorGor3.1:9:38490304:38550847:1 gene:ENSGGOG00000006929 transcript:ENSGGOT00000006962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEELETSLFQTRKAHRIEQMVARWLRRSRDSSARAKVAAADGPARNPTQTLIPVRHTVKI
DKDTLLQDYGFHISESLPLTVVAVTAGGSAHGKLFPGDQILQMNNEPAEDLSWERAVDIL
REAEDSLSITVVRCTSGVPKSSFLTEEKRARLKTNPVKVHFAEEVLISGHSQGNSLLCMP
NVLKLYLENGQTKAFKFEANTTVKDIILTVKEKLSIRSIEYFALALEEQYSISRLHLLHE
EELIQQVVEREESHDYRCLFRVCFVPKDPLDLLKEDPVAFEYLYLQSCSDVLQERFAVEM
KCSSALRLAALHIQERIYACAQPQKISLKYIEKDWGIENFISPTLLRNMKGKDIKKAISF
HMKRNQNLLEPRQKQLISAAQLRLNYLQILGELKTYGGRIFNATLMLQDRESYIALLVGA
KYGISQVINSKLNIMSTLAEFANISRVELTEESEKVSVVKVYLQDIKVLTLLLESNSAKD
LACLIAGYYRLLVDPVTSIFLWPGNKQQAHRVSAEEGYESRACSDSEESSEVDCVLEPLS
DRRLVKLAPCRSLIKEEQPPENSPTPEVARRGPSTCGASSTTDSAESEASDSANTESRGY
RTSGSSESMDALEEDDLDTCSSSRSTFFHFGSPGLAESIDSDSQEERSGIETSGFLCLLD
LAQRANRQCQKTEFSESAALETFGWAPELSTVRLDPRLYEGSHTDYYSLCSSVSPASYLS
DSSESTASRQGGAPPAWCQQGWTEAQPSSMLEPLALHPPLAFEDGSSDEEYYDAADKLTP
PGPPSGPRDVSTAEPSATSLQNKASTSSPENSLPCGPDGRQPSRRGGVKKYAKTLRKRRS
FLQTDYTSQVSFPLVPSASLESVDDVCYYDREPYLALGAPSPTVSSLQDMQGEPGLLETK
ALGLLAPLRETKSTNPASRVMEMEPETMETKSVIDSRVSSISAIRFRIDPNNKENSGVVP
VASSSASTPHCSNPGSSGPDTAQARPSQILPLSQDLDGTAPKEPTIEHGDSSFSLSSGDP
NPDRACLASNPGLNNVSPGDTLELQLEPHVQLEMGLQSFCTNHIQETAPKYTEPLLSPRD
EPKSDECGINPGEKIASVPTKEEPQGQLSLERDREVTNKNGTNVFQEESRKDSGDSPGDV
SNNVSQTLDISSPAGKIVTSLSLDAPVTGTEQIPPHPPRDPQGQSREPPGQGCQAQEQKL
FVELDLDPDFFLGKQTISSAVPPEGIKAEAPNHVTGEDIAPRDSPEWVCFNPEPSLPEPL
PCPQEDPHLETSNHCLLSEGKSDSSSICLSAEKSFLCFAPESHPEVSASLRVATSLGFAG
MNEMVAPRIGMDQCSCQFSYATCFRGPQPETEEEDRDLEAHPTAPLTSPPSAGSPVVLPW
RPARAHSCSTAPLSRKSHIWPEYCSRALRQLKATPASTPEGFIQLMESLLELQDILETSW
GVGNKHPPEKCTWHFTESRSRLCMGSQKLLSSCQHVIRMDQSPEEMQGAVRDTFQHLVQL
AGLCFQFTDCSRCSARHREAAGNLRDVVYTYHQFIEAAKSTCERGYHDLSVKLLARQCTA
LTAAVFCLTQKFRASTAL
Download sequence
Identical sequences ENSGGOP00000006784 ENSGGOP00000006784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]