SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006796 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006796
Domain Number 1 Region: 48-368
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.74e-124
Family Bee venom hyaluronidase 0.0000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006796   Gene: ENSGGOG00000006946   Transcript: ENSGGOT00000006975
Sequence length 509
Comment pep:known_by_projection chromosome:gorGor3.1:7:121999166:122009340:1 gene:ENSGGOG00000006946 transcript:ENSGGOT00000006975 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVLKFKHIFFRSFVKSSGVSQIVFTFLLIPCCLTLNFRAPPVIPNVPFLWAWNAPSKFC
LGKFDEPLDMSLFSLIGSPRINITGQGVTIFYVDRLGYYPYIDSITGVTVNGGIPQKISL
QDHLDKAKKDITFYMPVDNLGMAVIDWEEWRPTWARNWKPKDVYKNRSIELVQQQNVQLS
LTEATEKAKQEFEKAGKDFMVETIKLGKLLRPNHLWGYYLFPDCYNHHYKKPGYNGSCFN
VEIKRNDDLSWLWNESTALYPSIYLNTQQSPVAATLYVRNRVQEAIRVSKIPDAKSPLPV
FVYTRIVFTDQVLKFLSQDELVYTFGETVALGASGIVIWGTLSIMRSMKSCLLLDNYMET
ILNPYIINVTLAAKMCSQVLCQEQGVCIRKDWNSSDYLHLNPDNFAIQLEKGGKFTVRGK
PTLEDLEQFSEKFYCSCYSTLSCKEKADIKDTDAVDVCIADGVCIDAFLKPPMDTEESQI
FYNASPSTLSATMLIVSILFLIISSVARL
Download sequence
Identical sequences G3QVL9 H2DJA6
ENSGGOP00000006796 XP_018886147.1.27298 XP_018886148.1.27298 ENSGGOP00000006796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]