SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006818 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006818
Domain Number 1 Region: 231-397
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-39
Family SPRY domain 0.00027
Further Details:      
 
Domain Number 2 Region: 17-77
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000104
Family B-box zinc-binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006818   Gene: ENSGGOG00000006968   Transcript: ENSGGOT00000006997
Sequence length 402
Comment pep:known_by_projection chromosome:gorGor3.1:9:95883663:95903842:1 gene:ENSGGOG00000006968 transcript:ENSGGOT00000006997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAEGAEPGPGSGSGPGPGPLCPEHGQALSWFCGSERRPVCAACAGLGGRCRGHRIRRAE
ERAEELRNKIVDQCERLQLQSAAITKYVADVLPGKNQRAVSMASAARELVIQRLSLVRSL
CESEEQRLLEQVHGEEERAHQSILTQRVHWAEALQKLDTIRTGLVGMLTHLDDLQLIQKE
QEIFERTEEAEGILDPQESEMLNFNEKCTRSPLLTQLWATAVLGSLSGTEDIRIDERTVS
PFLQLSDDRKTLTFSTKKSKACADGPERFDHWPNALAATSFQNGLHAWMVNVQNSCAYKV
GVASGHLPRKGSGSDCRLGHNAFSWVFSRYDQEFRFSHNGQHEPLGLLRGPAQLGVVLDL
QAQELLFYEPASGTVLCAYHGSFLGPLFPVFAVADQTISIVR
Download sequence
Identical sequences G3QVP0
ENSGGOP00000006818 XP_004048518.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]