SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006820 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006820
Domain Number 1 Region: 19-107
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 7.43e-30
Family ECR1 N-terminal domain-like 0.00000267
Further Details:      
 
Domain Number 2 Region: 196-273
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.77e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000732
Further Details:      
 
Domain Number 3 Region: 108-192
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.69e-20
Family Cold shock DNA-binding domain-like 0.00000662
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006820   Gene: ENSGGOG00000006970   Transcript: ENSGGOT00000006999
Sequence length 275
Comment pep:known_by_projection chromosome:gorGor3.1:9:38588564:38593720:-1 gene:ENSGGOG00000006970 transcript:ENSGGOT00000006999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEAASVAAESLAGSRARAARTVLGQVVLPGEELLLPEQEDAEGPGGAVERPLSLNAGAC
SRVRVVCGPGLRRCGDRLLVTKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGI
VTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQVGDLIYGQFVVANKDMEPEMVC
IDSCGRANGMGVIGQDGLLFKVTLGLIRKLLAPDCEIIQEVGKLYPLEIVFGMNGRIWVK
AKTIQQTLILANILEACEHMTSDQRKQIFSRLAES
Download sequence
Identical sequences A0A2I2YV06
XP_004048094.1.27298 ENSGGOP00000006820 ENSGGOP00000006820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]