SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006833 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006833
Domain Number 1 Region: 387-584
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.25e-49
Family Nucleotide and nucleoside kinases 0.0001
Further Details:      
 
Domain Number 2 Region: 227-335
Classification Level Classification E-value
Superfamily SH3-domain 5.61e-23
Family SH3-domain 0.0013
Further Details:      
 
Domain Number 3 Region: 158-242
Classification Level Classification E-value
Superfamily PDZ domain-like 7.76e-20
Family PDZ domain 0.0012
Further Details:      
 
Domain Number 4 Region: 92-143
Classification Level Classification E-value
Superfamily L27 domain 0.0000000000000432
Family L27 domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006833   Gene: ENSGGOG00000006981   Transcript: ENSGGOT00000007012
Sequence length 588
Comment pep:known_by_projection chromosome:gorGor3.1:5:40272821:40303763:1 gene:ENSGGOG00000006981 transcript:ENSGGOT00000007012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELQYPPPPPSPRICRERSGGDNASMPVLSEDSGLHETLALLTSQLRPDSNHKEEMGFLR
DVFSEKSLSYLMKIHEKLRYYERQSPTPVLHSAVALAEDVMEELQAASVHSDERELLQLL
STPHLRAVLMVHDTVAQKNFDPVLPPLPDNIDEDFDEESVKIVRLVKNKEPLGATIRRDE
HSGAVVVARIMRGGAADRSGLVHVGDELREVNGIAVLHKRPDEISQILAQSQGSITLKII
PATQEEDRLKESKVFMRALFHYNPREDRAIPCQEAGLPFQRRQVLEVVSQDDPTWWQAKR
VGDTNLRAGLIPSKGFQEYDQPCDKETCDCEGYLKGHYVAGLRRSFRLGCRERLGGSQEG
KMSSGAESLELLTYEEVARYQHQSGERPRLVVLIGSLGARLHELKQKVVAENPQHFGVAV
PHTTRPRKSHEKEGVEYHFVSKQAFEADLHHNKFLEHGEYKENLYGTSLEAIQAVMAKNK
VCLVDVEPEALKQLRTSEFKPYIIFVKPAIQEKRKTPPMSPACEDTAAPFDEQQQEMAAS
AAFIDQHYGHLVDAVLVKEDLQGAYSQLKVVLEKLSKDTHWVPVSWVR
Download sequence
Identical sequences ENSGGOP00000006833 ENSGGOP00000025622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]