SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006841 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006841
Domain Number 1 Region: 144-288
Classification Level Classification E-value
Superfamily C-type lectin-like 1.38e-44
Family C-type lectin domain 0.000000126
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000006841
Domain Number - Region: 81-153
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.00248
Family Mitotic arrest deficient-like 1, Mad1 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006841   Gene: ENSGGOG00000006991   Transcript: ENSGGOT00000007020
Sequence length 321
Comment pep:known_by_projection chromosome:gorGor3.1:19:7901564:7914759:-1 gene:ENSGGOG00000006991 transcript:ENSGGOT00000007020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWYWDTTQSLKQLEERA
ARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADL
SSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKG
TKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHV
DYSNWAPGEPTSRSQGKDCVMMRGSGRWNDAFCHRKLGAWVCDRLATCTPPASEGSAESM
GPDSRPGPDGRLPAPSAPLHS
Download sequence
Identical sequences G3QVR0
ENSGGOP00000006841 XP_018870432.1.27298 ENSGGOP00000006841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]