SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006858 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006858
Domain Number 1 Region: 5-143
Classification Level Classification E-value
Superfamily PH domain-like 3.58e-45
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00000195
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000006858
Domain Number - Region: 223-321
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00647
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006858   Gene: ENSGGOG00000007011   Transcript: ENSGGOT00000007039
Sequence length 361
Comment pep:known_by_projection chromosome:gorGor3.1:19:19300813:19316846:-1 gene:ENSGGOG00000007011 transcript:ENSGGOT00000007039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTAREQPIFSTRAHVFQIDPATKRNWIPAGKHALTVSYFYDATRNVYRIISIGGAKAII
NSTVTPNMTFTKTSQKFGQWADSRANTVYGLGFASEQHLTQFAEKFQEVKEAARLAREKS
QDGGELTSPALGLASHQVPPSPLVSANGPGEEKLFRSQSADAPGPTERERLKKMLSEGSV
GEVQWEAEFFALQDSNNKLAGALREANAAAAQWRQQLEAQRAEAERLRQRVAELEAQAAS
EVTPTSEKEGLGQGQSLEQLEALVQTKDQEIQTLKSQTGGPREAPEAAEREETQQKVQDL
ETRNAELEHQLRAMERSLEEARAERERARAEVGRAAQLLDVRLFELSELREGLARLAEAA
P
Download sequence
Identical sequences A0A2I3S5I2 G3RT61
ENSPTRP00000018298 ENSGGOP00000018986 ENSGGOP00000006858 ENSPTRP00000018298 9598.ENSPTRP00000018298 XP_001137929.1.37143 XP_003817793.1.60992 XP_003817794.1.60992 XP_004060397.1.27298 XP_008969261.1.60992 XP_008969262.1.60992 XP_009433336.1.37143 XP_016791035.1.37143 XP_016791036.1.37143 XP_016791037.1.37143 XP_016791038.1.37143 XP_018871236.1.27298 XP_018871237.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]