SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006885 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006885
Domain Number 1 Region: 3-294
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.17e-102
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000000468
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006885   Gene: ENSGGOG00000007036   Transcript: ENSGGOT00000007067
Sequence length 435
Comment pep:known_by_projection chromosome:gorGor3.1:20:48455758:48529687:1 gene:ENSGGOG00000007036 transcript:ENSGGOT00000007067 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLH
QEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLK
CAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWP
DFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKD
PSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLE
PPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQKDKDCPIKEEKGSPLNAAPYG
IESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSPPEKDEDHALSYWKPFLVNMCVATVLT
AGAYLCYRFLFNSNT
Download sequence
Identical sequences G3QVU9
XP_004062408.1.27298 ENSGGOP00000006885 ENSGGOP00000006885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]