SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006886 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006886
Domain Number 1 Region: 68-147
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.4e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.000038
Further Details:      
 
Domain Number 2 Region: 168-248
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.42e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.000033
Further Details:      
 
Domain Number 3 Region: 259-345
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.97e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000464
Further Details:      
 
Domain Number 4 Region: 360-432
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.77e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006886   Gene: ENSGGOG00000007028   Transcript: ENSGGOT00000007068
Sequence length 645
Comment pep:known_by_projection chromosome:gorGor3.1:19:6593575:6604211:-1 gene:ENSGGOG00000007028 transcript:ENSGGOT00000007068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDYSTGGPPPGPPPPAIAAKIGGDAATTVNNSTPDFGFGGQKRQLEDGDQPESKKLASQ
GDSISSQLGPIHPPPRTSMTEEYRVPDGMVGLIIGRGGEQINKIQQDSGCKVQISPDSGG
LPERSVSLTGAPESVQKAKMMLDDIVSRGRGGPPGQFHDNANGGQNGTVQEIMIPAGKAG
LVIGKGGETIKQLQERAGVKMILIQDGSQNTNVDKPLRIIGDPYKVQQACEMVMDILRER
DQGGFGDRNEYGSRIGGGIDVPVPRHSVGVVIGRSGEMIKKIQNDAGVRIQFKQDDGTGP
EKIAHIMGPPDRCEHAARIINDLLQSLRSGPPGPPGGPGMPPGGRGRGRGQGNWGPPGGE
MTFSIPTHKCGLVIGRGGENVKAINQQTGAFVEISRQLPPNGDPNFKLFIIRGSPQQIDH
AKQLIEEKIEGPLCPVGPGPGGPGPAGPMGPFNPGPFNQGPPGAPPHAGGPPPHQYPPQG
WGNTYPQWQPPAPHDPSKAAAAAADPNAAWAAYYSHYYQQPPGPVPGPAPAPAAPPAQGE
PPQPPPTGQSDYTKAWEEYYKKIGQQPQQPGAPPQQDYTKAWEEYYKKQAQVATGGGPGA
PPGSQPDYSAAWAEYYRQQAAYYGQTPGPGGPQPPPTQQGQQQAQ
Download sequence
Identical sequences G3QVV0
ENSGGOP00000006886 ENSGGOP00000017537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]