SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006894 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006894
Domain Number 1 Region: 32-61,180-350
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.08e-63
Family G proteins 0.0000000303
Further Details:      
 
Domain Number 2 Region: 61-182
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 1.07e-42
Family Transducin (alpha subunit), insertion domain 0.00000199
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006894   Gene: ENSGGOG00000007047   Transcript: ENSGGOT00000007076
Sequence length 355
Comment pep:known_by_projection chromosome:gorGor3.1:3:51538377:51561461:1 gene:ENSGGOG00000007047 transcript:ENSGGOT00000007076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEEECRQYRAVVYSNTIQSIMAIVKAMGNLQIDFADPSRADDARQLFALSCTAEEQGVL
PDDLSGIIRRLWADHGVQACFGRSREYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRV
KTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEE
MNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKITHSPLTICFPEYTGANKYDEA
ASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
Download sequence
Identical sequences G3QVV7
ENSGGOP00000006894 XP_003818865.1.60992 XP_004034228.1.27298 ENSGGOP00000006894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]