SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006897 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006897
Domain Number 1 Region: 46-142
Classification Level Classification E-value
Superfamily Cystatin/monellin 9.07e-26
Family Cystatins 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006897   Gene: ENSGGOG00000007052   Transcript: ENSGGOT00000007080
Sequence length 147
Comment pep:novel chromosome:gorGor3.1:20:24141420:24144308:-1 gene:ENSGGOG00000007052 transcript:ENSGGOT00000007080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWSLPRSRALSWAPLLLLFSFQFLVTYAWRFQEEEEWNDQKQITVYLPPTLEFAVYTFNK
QSKDWYAYKLVHVLDSWKEQGYDKMTFSMNLQLGRTMCGKFEDDIDNCPFQESPELNNTC
TCFFTIGIEPWRTRFDLWNKTCSGGHS
Download sequence
Identical sequences ENSGGOP00000006897 ENSGGOP00000006897 XP_004061954.2.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]