SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006899 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006899
Domain Number 1 Region: 159-258,381-478,895-1129
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.96e-69
Family Calcium ATPase, transmembrane domain M 0.015
Further Details:      
 
Domain Number 2 Region: 479-495,641-751,821-898
Classification Level Classification E-value
Superfamily HAD-like 1.59e-30
Family Meta-cation ATPase, catalytic domain P 0.01
Further Details:      
 
Domain Number 3 Region: 490-700
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 1.37e-21
Family Metal cation-transporting ATPase, ATP-binding domain N 0.01
Further Details:      
 
Domain Number 4 Region: 266-383
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 7.85e-19
Family Calcium ATPase, transduction domain A 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006899   Gene: ENSGGOG00000007037   Transcript: ENSGGOT00000007082
Sequence length 1218
Comment pep:known_by_projection chromosome:gorGor3.1:3:194946637:195052092:-1 gene:ENSGGOG00000007037 transcript:ENSGGOT00000007082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEENSKKDHRALLNQGEEDELEVFGYRDHNVRKAFCLVASVLTCGGLLLVFYWRPQWRVW
ANCIPCPLQEADTVLLRTTDEFQRYMRKKVFCLYLSTLKFPVSKKWEESLVADRHSVINQ
ALIKPELKLRCMQVQKIRYVWNDLEKRFQKVGLLEDSNSCSDIHQTFGLGLTSEEQEVRR
LVCGPNAIEVEIQPIWKLLVKQVLNPFYVFQAFTLTLWLSQGYIEYSVAIIILTVISIVL
SVYDLRQQSVKLHNLVEDHNKVQVTIIVKDKGLEELESRLLVPGDILILPGKFSLPCDAV
LIDGSCVVNEGMLTGESIPVTKTPLPQMENTMPWKCHSLEDYRKHVLFCGTEVIQVKPSG
QRPVRAVVLQTGYNTAKGDLVRSILYPRPLNFKLYSDAFKFIVFLACLGVMGFFYALGVY
MYHGVPPKDTVTMALILLTVTVPPVLPAALTIGNVYAQKRLKKKKIFCISPQRINMCGQI
NLVCFDKTGTLTEDGLDLWGTVPTADNCFQEAHSFASGQAVPWGPLCAAMASCHSLILLH
GTIQGDPLDLKMFEGTAWKMEDCNVDSCKFGTSVSNIIKPGPKASKSPVEAIITLRQFPF
SSSLQRMSVVAQLAGENHFHAYMKGAPEMVARFCRSETVPKNFPQELRSYTVQGFRVIAL
AHKTLKMGNLSEVEHLAREKVESELTFLGLLIMENRLKKETKLVLKELSEARIRTVMITG
DNLQTAITVAKNSEMIPPGSQVIIVEANEPEEFVPASVTWQLVENQETGPGKKETYMHTG
NSSTPRGERGSCYHFAMSGKSYQVIFQHFNSLLPKILVNGTVFARMSPGQKSSLIEEFQK
LNYYVGMCGDGANDCGALKVAHAGISLSEQEASVASPFTSKTTNIQCVPHLIREGRAALV
SSFGVFKYLTMYGIIQFISALLLYWQLQLFGNYQYLMQDVAITLMVCLTMSSTHAYPKLA
PYRPAGQLLSPPLLLSIFLNSCFSCIVQISAFLYVKQQPWYCEVYQYSECFLANQSNFST
NVSLERNWTGNATPIPGSILSFETTTLWPITTINYITVAFIFSKGKPFRKPIYTNYIFSF
LLLAALGLTIFILFSDFQVIYRGMELIPTITSWRVLILVVALTQFCVAFFVEDSILQNHE
LWLLIKREFGFYSKSQYRTWQKKLAEDSTWPPINRTDYSGDGKNGFYINGGYESHEQIPK
RKLKLGGQPTEQHFWARL
Download sequence
Identical sequences ENSGGOP00000006899 ENSGGOP00000006899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]