SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006906 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006906
Domain Number 1 Region: 232-457
Classification Level Classification E-value
Superfamily Mitochondrial carrier 8.63e-66
Family Mitochondrial carrier 0.000065
Further Details:      
 
Domain Number 2 Region: 7-160
Classification Level Classification E-value
Superfamily EF-hand 2.01e-33
Family Calmodulin-like 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006906   Gene: ENSGGOG00000007058   Transcript: ENSGGOT00000007091
Sequence length 482
Comment pep:known_by_projection chromosome:gorGor3.1:19:6618683:6640487:-1 gene:ENSGGOG00000007058 transcript:ENSGGOT00000007091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGSPGDAERRQRWGRLFEELDSNKDGRVDVHELRQGLARLGGGNPDPGAQQGISSEGDA
DPDGGLDLEEFSRYLQEREQRLLLMFHSLDRNQDGHIDVSEIQQSFRALGISISLEQAEK
ILHSMDRDGTMTIDWQEWRDHFLLHSLENVEDVLYFWKHSTLPSAGFSAWIKDSTAEQNR
SKTTVLARHSGSRLKSQHFGRPKWADHEVLDIGECLTVPDEFSKQEKLTGMWWKQLVAGA
VAGAVSRTGTAPLDRLKVFMQVHASKTNRLNILGGLRSMVLEGGVRSLWRGNGINVLKIA
PESAIKFMAYEQIKRAILGQQETLHVQERFVAGSLAGATAQTIIYPMEVLKTRLTLRRTG
QYKGLLDCARRILEREGPRAFYRGYLPNVLGIIPYAGIDLAVYETLKNWWLQQYSHDSAD
PGILVLLACGTISSTCGQIASYPLALVRTRMQAQGWSTVARFRITATSASQVQAILLPQP
PE
Download sequence
Identical sequences ENSGGOP00000006906 ENSGGOP00000006906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]