SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006917 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006917
Domain Number 1 Region: 153-257,381-478,893-1125
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.11e-67
Family Calcium ATPase, transmembrane domain M 0.01
Further Details:      
 
Domain Number 2 Region: 480-495,642-749,819-897
Classification Level Classification E-value
Superfamily HAD-like 2.64e-32
Family Meta-cation ATPase, catalytic domain P 0.0034
Further Details:      
 
Domain Number 3 Region: 490-698
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 2.83e-22
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0084
Further Details:      
 
Domain Number 4 Region: 268-383
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 2.75e-18
Family Calcium ATPase, transduction domain A 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006917   Gene: ENSGGOG00000007060   Transcript: ENSGGOT00000007102
Sequence length 1196
Comment pep:known_by_projection chromosome:gorGor3.1:3:195075461:195232834:-1 gene:ENSGGOG00000007060 transcript:ENSGGOT00000007102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHFEKGQHALLNEGEENEMEIFGYRTQGCRKSLCLAGSIFSFGILPLVFYWRPAWHVWA
HCVPCSLQEADTVLLRTTDEFQIYSWKKVIWIYLSALNSAFGLTPDHPLMTDEEYIINRA
IRKPDLKVRCIKVQKIRYVWNYLEGQFQKIGSLEDWLSSAKIHQKFGSGLTREEQEIRRL
ICGPNTIDVEVTPIWKLLIKEVLNPFYIFQLFSVCLWFSEDYKEYAFAIIIMSIISISLT
VYDLREQSVKLHHLVESHNSITVSVCGRKAGVQELESRVLVPGDLLILTGNKVLMPCDAV
LIEGSCVVDEGMLTGESIPVTKTPLPKMDSSVPWKTQSEADYKRHVLFCGTEVIQAKAAC
SGTVRAVVLQTGFNTAKGDLVRSILYPKPVNFQLYRDAIRFLLCLVGTATIGMIYTLCVY
VLSGEPPEEVVRKALDVITIAVPPALPAALTTGIIYAQRRLKKRGIFCISPQRINVCGQL
NLVCFDKTGTLTRDGLDLWGVVSCDRNGFQEVHSFASGQAVPWGPLCAAMASCHSLILLD
GTIQGDPLDLKMFEATTWEMAFSGDDFHIKGVPAHAMVVKPCRTASQVPVEGIAILHQFP
FSSALQRMTVIVQEMGGDRLAFMKGAPERVASFCQPETVPTSFVSELQIYTTQGFRVIAL
AYKKLENDHHATTLTRETVESDLIFLGLLILENRLKEETKPVLEELISARIRTVMITGDN
LQTAITVARKSGMVSESQKVILIEANETTGSSSASISWTLVEEKKHITYGNQDNYINIRD
EVSDKGREGSYHFALTGKSFDVISQHFSSLLPKILINGTIFARMSPGQKSSLVEEFQKLD
YFVGMCGDGANDCGALKMAHVGISLSEQEASVASPFTSKTPNIECVPHLIKEGRAALVTS
FCMFKYMALYSMIQYVGVLLLYWETNSLSNYQFLFQDLAITTLIGVTMNLNGAYPKLVPF
RPAGRLISPPLLLSVIFNILLSLAMHVAGFILVQRQPWYSVEIHSACTVQNESISELTVS
PTAPEKMESNSAFTSFENTTIWFLGTINCIIVALVFSKGKPFRQPTYTNYIFVLVLIIQL
GVCLFILFADIPELYRRLDLLCTPVLWRASIVIMLSLNFIVSLVAEEAVIENRALWMMIK
RCFGYQSKSQYRIWQRDLANDPSWPPLNQTSHSDMPECGRGVSYSNPVFESNEEQL
Download sequence
Identical sequences G3QVX9
XP_004038269.1.27298 ENSGGOP00000006917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]