SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006938 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006938
Domain Number 1 Region: 280-381
Classification Level Classification E-value
Superfamily RING/U-box 1.08e-26
Family Zf-UBP 0.0044
Further Details:      
 
Domain Number 2 Region: 263-308
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000404
Family RING finger domain, C3HC4 0.0092
Further Details:      
 
Domain Number 3 Region: 152-228
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000885
Family Canonical RBD 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006938   Gene: ENSGGOG00000007087   Transcript: ENSGGOT00000007123
Sequence length 439
Comment pep:known_by_projection chromosome:gorGor3.1:12:111206622:111238535:-1 gene:ENSGGOG00000007087 transcript:ENSGGOT00000007123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVSLVVIRLELAEHSPVPAGFGFSAAAGEMSDEEIKKTTLASAVACLEGKSPGEKVAII
HQHLGRREMTDVIIETMKSNPDELKTTVEERKSSEASPTAQRSKDHSKECINAAPDSPSK
QLPDQISFFSGNPSVEIVHGIMHLYKTNKMTSLKEDVRRSAMLCILTVPAAMTSHDLMKF
VAPFNEVIEQMKIIRDSTPNQYMVLIKFSAQADADSFYMACNGRQFNSIEDDVCQLVYVE
RAEVLKSEDGASLPVMDLTELPKCTVCLERMDESVNGILTTLCNHSFHSQCLQRWDDTTC
PVCRYCQTPEPVEENKCFECGVQENLWICLICGHIGCGRYVSRHAYKHFEETQHTYAMQL
TNHRVWDYAGDNYVHRLVASKTDGKIVQYECEGDTCQEEKIDALQLEYSYLLTSQLESQR
IYWENKIVRIEKDTAEEVS
Download sequence
Identical sequences ENSGGOP00000006938 ENSGGOP00000006938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]