SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006979 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006979
Domain Number 1 Region: 6-169
Classification Level Classification E-value
Superfamily EF-hand 8.87e-50
Family Calmodulin-like 0.000000072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006979   Gene: ENSGGOG00000021945   Transcript: ENSGGOT00000007165
Sequence length 202
Comment pep:known_by_projection chromosome:gorGor3.1:8:100881119:100907321:-1 gene:ENSGGOG00000021945 transcript:ENSGGOT00000007165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILAARMGKQNSKLRPEVMQDLLESTDFTEHEIQEWYKGFLRDCPSGHLSMEEFKKIYGNF
FPYGDASKFAEHVFRTFDANGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGY
ISKAEMLEIVQAIYKMVSSVMKMPEDESTPEKRTEKIFRQMDTNRDGQLLPPRKQNGSCG
ARMKGTKKPLLAQTHPWDRPRL
Download sequence
Identical sequences Q59GU4
ENSGGOP00000006979 ENSGGOP00000021376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]