SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006987 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006987
Domain Number 1 Region: 2-361
Classification Level Classification E-value
Superfamily Sema domain 6.93e-97
Family Sema domain 0.0000311
Further Details:      
 
Domain Number 2 Region: 1307-1436,1632-1820
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.67e-51
Family p120GAP domain-like 0.037
Further Details:      
 
Domain Number 3 Region: 908-997
Classification Level Classification E-value
Superfamily E set domains 3.38e-18
Family Other IPT/TIG domains 0.054
Further Details:      
 
Domain Number 4 Region: 996-1099
Classification Level Classification E-value
Superfamily E set domains 3.69e-16
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.054
Further Details:      
 
Domain Number 5 Region: 812-909
Classification Level Classification E-value
Superfamily E set domains 0.00000000000152
Family Other IPT/TIG domains 0.014
Further Details:      
 
Domain Number 6 Region: 465-516
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000641
Family Plexin repeat 0.0016
Further Details:      
 
Domain Number 7 Region: 1096-1177
Classification Level Classification E-value
Superfamily E set domains 0.000000077
Family E-set domains of sugar-utilizing enzymes 0.044
Further Details:      
 
Domain Number 8 Region: 764-798
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000432
Family Plexin repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006987   Gene: ENSGGOG00000004420   Transcript: ENSGGOT00000007173
Sequence length 1851
Comment pep:known_by_projection chromosome:gorGor3.1:1:188052985:188164794:-1 gene:ENSGGOG00000004420 transcript:ENSGGOT00000007173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RDWTFNHLTVHRGTGAVYVGAINRVYKLTGNLTIQVAHKTGPEEDNKSCYPPLIVQPCSE
VLTLTNNVNKLLIIDYSENRLLACGSLYQGVCKLLRLDDLFILVEPSHKKEHYLSSVNKT
GTMYGVIVRSEGEDGKLFIGTAVDGKQDYFPTLSSRKLPRDPESSAMLDYELHSDFVSSL
IKIPSDTLALVSHFDIFYIYGFASGGFVYFLTVQPETPEGVAINSAGDLFYTSRIVRLCK
DDPKFHSYVSLPFGCTRAGVEYRLLQAAYLAKPGDSLAQAFNITSQDDVLFAIFSKGQKQ
YHHPPDDSALCAFPIRAINLQIKERLQSCYQGEGNLELNWLLGKDVQCTKAPKPTGPNQC
GELLASELGNLIIIEGLPFMIETAPGSASGAGDTCEDRCTIWQGRFQGRFQSLRAPGLPH
GGEKSLVYAMEDAVEVSPSYLLSPCQRQNTVLLDHRVTRVPVESCEQYTTCGECLSSGDP
HCGWCALHNMCSRRDKCQQAWEPNRFAASISQCVSLAVHPSSISVSEHSQLLSLVVSDAP
DLSAGIACAFGNLTEVEGQVSGSQVICISPGPKDVPVIPLDQVFPDWFGLELQLRSKETG
KIFVSTEFKFYNCSAHQLCLSCVNSAFRCHWCKYRNLCTHDPTTCSFQEGRINISEDCPQ
LVPTEEILIPVGEVKPITLKARNLPQPQSGQRGYECVLNIQGAIHRVPALRFNSSSVQCQ
NSSYQYDGMDISNLAVDFAVVWNGNFIIDNPQDLKVHLYKCAAQRESCGLCLKADRKFEC
GWCSGERRCTLHQHCTSPSSPWLDWSSHNVKCSNPQITEILTVSGPPEGGTRVTIHGVNL
GLDFSEIAHHVQVAGVPCTPLPGEYIIAEQIVCEMGHALVGTTSGPVRLCIGECKPEFMT
KSHQQYTFVNPSVLSLNPIRGPESGGTMVTITGHYLGAGSSVAVYLGNQTCEFYGRSMSE
IVCVSPPSSNGLGPVPVSVSVDRAHVDNNLQFEYIDDPRVQRIEPEWSIASGHTPLTITG
FNLDVIQEPRIRVKFNGKESVNVCKVVNTTTLTCLAPSLTTDYRPGLDTVERPDEFGFVF
NNVQSLLIYNDTKFIYYPNPTFELLSPTGVLDQKPGSPIILKGKNLCPPASGGAKLNYTV
LIGETPCAVTVSETQLLCEPPNLTGQHKVMVHVGGMVFSPGSVSVISDSLLTLPAIVSIA
AGGSLLLIIVIIVLIAYKRKSRENDLTLKRLQMQMDNLESRVALECKEAFAELQTDINEL
TSDLDRSGIPYLDYRTYAMRVLFPGIEDHPVLRELEVQGNGQQHVEKALKLFAQLINNKV
FLLTFIRTLELQRSFSMRDRGNVASLIMTGLQGRLEYATDVLKQLLSDLIDKNLENKNHP
KLLLRRTESVAEKMLTNWFAFLLHKFLKECAGEPLFMLYCAIKQQMEKGPIDAITGEARY
SLSEDKLIRQQIEYKTLILNCVNPDNENSPEIPVKVLNCDTITQVKEKILDAVYKNVPYS
QRPRAVDMDLEWRQGRIARVVLQDEDITTKIEGDWKRLNTLMHYQVSDRSVVALVPKQTS
SYNIPASASISRTSISRYDSSFRYTGSPDSLRSRAPMITPDLESGVKVWHLVKNHDHGDQ
KEGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETLFSTVHRGSALPLAIKYMFDFLDEQ
ADRHSIHDTDVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKGSITDACLSVVAQTFMDSCS
TSEHRLGKDSPSNKLLYAKDIPSYKSWVERYYADIAKLPAISDQDMNAYLAEQSRLHAVE
FNMLSALNEIYSYVSKYSEELIGALEQDEQARRQRLAYKVEQLINAMSIES
Download sequence
Identical sequences ENSGGOP00000004340 ENSGGOP00000006987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]