SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007021 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007021
Domain Number 1 Region: 282-574
Classification Level Classification E-value
Superfamily Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 6.28e-106
Family Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.00000000675
Further Details:      
 
Domain Number 2 Region: 7-278
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.72e-66
Family G proteins 0.00000000876
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007021   Gene: ENSGGOG00000007171   Transcript: ENSGGOT00000007207
Sequence length 587
Comment pep:known_by_projection chromosome:gorGor3.1:1:91663585:91672432:-1 gene:ENSGGOG00000007171 transcript:ENSGGOT00000007207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALEIHMSDPMCLIENFNEQLKVNQEALEILSAITQPVVVVAIVGLYRTGKSYLMNKLAG
KNKGFSVASTVQSHTKGIWIWCVPHPNWPNHTLVLLDTEGLGDVEKADNKNDIQIFALAL
LLSSTFVYNTVNKIDQGAIDLLHNVTELTDLLKARNSSDLDRVEDPADSASFFPDLVWTL
RDFCLGLEIDGQLVTPEEYLENSLKPKQGSDQRVQNFSLPRLCIQKFFPKKKCFIFDLPA
HQKKLAQLETLPDDELEPEFVQQVTEFCSYIFSHSMTKTLPGGIVVNGSRLKNLVLTYVN
AISSGDLPCIENAVLALAQRENSAAVQKAIAHYDQQMGQKVQLPMETLQELLDLHRASER
EAIEVFMKNSFKDVDQSFQKELETLLDAKQNDICKRNSEASSDHCSALLKDIFGPLEEAV
KQGIYSKPGGHNLFIQKTEELKAKYYQEPRKGIQAEEVLQKYLKSKESVSHAILQTDQAL
TEEEKKKKEAQVKAEAAKAEAQRLAAIRRQNEQMMQERERLHQEQVRQMEIAKQNWLAEQ
QKMQEQQMQEQAAQLSTTFQAQSRSLLNELQHAQRTVKRSMCFTLKC
Download sequence
Identical sequences ENSGGOP00000007021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]