SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007056 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007056
Domain Number 1 Region: 65-347
Classification Level Classification E-value
Superfamily L domain-like 9.18e-58
Family Ngr ectodomain-like 0.000000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007056   Gene: ENSGGOG00000007211   Transcript: ENSGGOT00000007242
Sequence length 371
Comment pep:known_by_projection chromosome:gorGor3.1:X:151442088:151459248:1 gene:ENSGGOG00000007211 transcript:ENSGGOT00000007242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSAMWPLWLLVSLLALSQALPFEQRGFWDFTLDDGPFLMNDEEASGADTSGVLDPDSVTP
TYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLY
ALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKG
VFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLD
HNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLP
DLKLLQVVYLHSNNITKVGVNDFCPVGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTD
RLAIQFGNYKK
Download sequence
Identical sequences ENSGGOP00000007056 ENSGGOP00000007056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]