SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007085 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007085
Domain Number 1 Region: 131-181,372-604
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 6.81e-56
Family FolH catalytic domain-like 0.00000000132
Further Details:      
 
Domain Number 2 Region: 191-382
Classification Level Classification E-value
Superfamily PA domain 7.98e-56
Family PA domain 0.00000000494
Further Details:      
 
Domain Number 3 Region: 609-756
Classification Level Classification E-value
Superfamily Transferrin receptor-like dimerisation domain 9.16e-51
Family Transferrin receptor-like dimerisation domain 0.0000000481
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007085   Gene: ENSGGOG00000007229   Transcript: ENSGGOT00000007271
Sequence length 760
Comment pep:known_by_projection chromosome:gorGor3.1:3:197703335:197736790:-1 gene:ENSGGOG00000007229 transcript:ENSGGOT00000007271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMDQARSAFSNLFGGEPLSYTRFSLARQVDGDNSHVEMKLAVDEEENADNNTKANVTKPK
RCSGSICYGTIAVIVFFLIGFMIGYLGYCKGVEPKTECERLAGAESPVREEPGEDFPAAR
RLYWDDLKRKLSEKLDTTDFTSTIKLLNENSYVPREAGSQKDENLALYVENQFREFKLSK
VWRDQHFVKIQVKDSAQNSVIIVDKNGRLVYLVENPGGYVAYSKAATVTGKLVHANFGTK
KDFEDLDTPVNGSIVIVRAGKITFAEKVANAESLNAIGVLIYMDQTKFPIVNAELSFFGH
AHLGTGDPYTPGFPSFNHTQFPPSRSSGLPNIPVQTISRAAAEKLFGNMEGDCPSDWKTD
STCRMVTSESKNVKLTVSNVLKEIKILNIFGVIKGFVEPDHYVVVGAQRDAWGPGAAKSG
VGTALLLKLAQMFSDMVLKDGFQPSRSIIFASWSAGDFGSVGATEWLEGYLSSLHLKAFT
YINLDKAVLGTSNFKVSASPLLYTLIEKTMQNVKHPVTGQFLYQDSNWASKVEKLTLDNA
AFPFLAYSGIPAVSFCFCEDTDYPYLGTTMDTYKELIERIPELNKVARAAAEVAGQFVIK
LTHDVELNLDYERYNSQLLSFVRDLNQYRADIKEMGLSLQWLYSARGDFFRATSRLTTDF
GNAEKTDRFVMKKLNDRVMRVEYHFLSPYVSPKESPFRHVFWGSGSHTLPALLENLKLRK
QNNGAFNETLFRNQLALATWTIQGAANALSGDVWDIDNEF
Download sequence
Identical sequences G3QWC9
ENSGGOP00000007085 ENSGGOP00000007085 XP_004038298.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]