SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007087 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007087
Domain Number 1 Region: 20-107
Classification Level Classification E-value
Superfamily EF-hand 4.9e-19
Family S100 proteins 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007087   Gene: ENSGGOG00000007241   Transcript: ENSGGOT00000007273
Sequence length 110
Comment pep:known_by_projection chromosome:gorGor3.1:1:132510144:132514734:-1 gene:ENSGGOG00000007241 transcript:ENSGGOT00000007273 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPAAWILWAHSHSELHTVMETPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELVKKEL
CLGEMKESRIDDLMKSLDKNSDQEIDFKEYSVFLTTLCMAYNDFFLEDNK
Download sequence
Identical sequences ENSGGOP00000007087 ENSGGOP00000007087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]