SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007126 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007126
Domain Number 1 Region: 39-238
Classification Level Classification E-value
Superfamily EF-hand 1.2e-44
Family Calmodulin-like 0.0000000529
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007126   Gene: ENSGGOG00000007280   Transcript: ENSGGOT00000007313
Sequence length 241
Comment pep:known_by_projection chromosome:gorGor3.1:5:154988911:155220941:1 gene:ENSGGOG00000007280 transcript:ENSGGOT00000007313 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAVMGTFSSLQTKQRRPSKDKIEDELEMTMVCHRPEGLEQLEAQTNFTKRELQVLYRGF
KNECPSGVVNEDTFKQIYAQFFPHGALPCLEGSPCVEFLPPSPALLFCLVDASTYAHYLF
NAFDATQTGSVKFEDFVTALSILLRGTVHEKLRWTFNLYDINKDGYINKEEMMDIVKAIY
DMMGKYTYPVLKEDTPRQHVDVFFQKMDKNKDGIVTLDEFLESCQEDDNIMRSLQLFQNV
M
Download sequence
Identical sequences G3QWG8
ENSGGOP00000007126 ENSGGOP00000007126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]