SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007133 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007133
Domain Number 1 Region: 39-281
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.19e-51
Family Ankyrin repeat 0.00017
Further Details:      
 
Domain Number 2 Region: 280-322
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000126
Family SOCS box-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007133   Gene: ENSGGOG00000007286   Transcript: ENSGGOT00000007320
Sequence length 323
Comment pep:known_by_projection chromosome:gorGor3.1:X:15238571:15274195:-1 gene:ENSGGOG00000007286 transcript:ENSGGOT00000007320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDGPVFYGFKNIFITMFATFFFFKLLIKVFLALLTHFYIVKGNRKEAARIAEEIYGGIS
DCWADRSPLHEAAAQGRLLALKTLIAQGVNVNLVTINRVSSLHEACLGGHVACAKALLEN
GAHVNGVTVHGATPLFNACCSGSAACVNVLLEFGAKAQFEVHLASPIHEAVKRGHRECME
ILLANNVNIDHEVPQLGTPLYVACTYQRVDCVKKLLELGASVDHGQWLDTPLHAAARQSN
VEVIHLLTDYGANLKRRNAQGKSALDLAAPKSSVEQALLLREGPPALSQLCRLCVRKCLG
RACHQAIHKLNLPEPLERFLLYQ
Download sequence
Identical sequences G3QWH5
ENSGGOP00000007133 XP_018874636.1.27298 ENSGGOP00000007133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]