SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007168 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007168
Domain Number 1 Region: 303-331,363-564
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.68e-59
Family Voltage-gated potassium channels 0.00058
Further Details:      
 
Domain Number 2 Region: 176-272
Classification Level Classification E-value
Superfamily POZ domain 8.9e-27
Family Tetramerization domain of potassium channels 0.00000446
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007168   Gene: ENSGGOG00000007324   Transcript: ENSGGOT00000007358
Sequence length 653
Comment pep:known_by_projection chromosome:gorGor3.1:11:30438337:30445043:-1 gene:ENSGGOG00000007324 transcript:ENSGGOT00000007358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVAMVSAESSGCNSHMPYGYAAQARARERERLAHSRAAAAAAVAAATAAVEGSGGSGGG
SHHHHQSRGACTSHDPQSSRGSRRRRRQRSEKKKAHYRQSSFPHCSDLMPSGSEEKILRE
LSEEEEDEEEEEEEEEEGRFYYSEDDHGDECSYTDLLPQDEGGGGYSSVRYSDCCERVVI
NVSGLRFETQMKTLAQFPETLLGDPEKRTQYFDPLRNEYFFDRNRPSFDAILYYYQSGGR
LKRPVNVPFDIFTEEVKFYQLGEEALLKFREDEGFVREEEDRALPENEFKKQIWLLFEYP
ESSSPARGIAIVSVLVILISIVIFCLETLPEFRDDRDLVMALSAGGHGGLLNDTSAPHLE
NSGHTIFNDPFFIVETVCIVWFSFEFVVRCFACPSQALFFKNIMNIIDIVSILPYFITLG
TDLAQQQGGGNGQQQQAMSFAILRIIRLVRVFRIFKLSRHSKGLQILGHTLRASMRELGL
LIFFLFIGVILFSSAVYFAEADEPTTHFQSIPDAFWWAVVTMTTVGYGDMKPITVGGKIV
GSLCAIAGVLTIALPVPVIVSNFNYFYHRETENEEQTQLTQNAVSCPYLPSNLLKKFRSS
TSSSLGDKSEYLEMEEGVKESLCAKEDKCQGKGDDSETDKNNCSNAKAVETDV
Download sequence
Identical sequences XP_004050913.1.27298 ENSGGOP00000007168 ENSGGOP00000007168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]