SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007184 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007184
Domain Number 1 Region: 24-271
Classification Level Classification E-value
Superfamily Caspase-like 1.12e-78
Family Caspase catalytic domain 0.00000000242
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007184   Gene: ENSGGOG00000007342   Transcript: ENSGGOT00000007374
Sequence length 273
Comment pep:known_by_projection chromosome:gorGor3.1:10:127638251:127644595:1 gene:ENSGGOG00000007342 transcript:ENSGGOT00000007374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FTSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDA
EALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKD
GVTPIKDLTAHFRGDRCKTLLEKPKLFFIQKSARADLSHTHVSDIYQVGTSIKTDSRVKS
FLKSRCESAIYSFSLVEGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVA
RHFESQSDDPRFHEKKQIPCVVSMLTKELYFSQ
Download sequence
Identical sequences ENSGGOP00000007184 ENSGGOP00000007184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]