SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007205 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007205
Domain Number 1 Region: 182-469
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.1e-96
Family Nuclear receptor ligand-binding domain 0.0000000000364
Further Details:      
 
Domain Number 2 Region: 78-162
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.43e-26
Family Nuclear receptor 0.000086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007205   Gene: ENSGGOG00000007361   Transcript: ENSGGOT00000007396
Sequence length 473
Comment pep:known_by_projection chromosome:gorGor3.1:3:119342085:119377906:1 gene:ENSGGOG00000007361 transcript:ENSGGOT00000007396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVTRTHHFKEGSLRAPATPLHSAAAELASNHPRGPEANLEVRPKESWNHADFVHCEDTE
SVPGKPSVNADEEVGGPQICRVCGDKATGYHFNVMTCEGCKGFFRRAMKRNARLRCPFRK
GACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQ
GLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELPESLQAPSREEAAKWSQ
VRKDLCSLKVSLQLRGEDGSVWNYKPPADNGGKEIFSLLPHMADMSTYMFKGIINFAKVI
SYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWECGRLSYCLEDTAGGFQQLLLE
PMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVVQHRVVDQLQEQFAITLKSYIECNR
PQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGS
Download sequence
Identical sequences G3QWP1
ENSGGOP00000018016 ENSGGOP00000007205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]