SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007261 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007261
Domain Number 1 Region: 59-130
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.1e-17
Family HLH, helix-loop-helix DNA-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007261   Gene: ENSGGOG00000007421   Transcript: ENSGGOT00000007453
Sequence length 190
Comment pep:known_by_projection chromosome:gorGor3.1:11:2231980:2232576:-1 gene:ENSGGOG00000007421 transcript:ENSGGOT00000007453 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDAGAMDGGALPRSAPPAPRVPVGCAARRRPASPELLRCSRRRRPATAETGGGAAAVARR
NERERNRVKLVNLGFQALRQHVPHGGASKKLSKVETLRSAVEYIRALQRLLAEHDAVRNA
LAGGLRPQAVRPSTPVAASPSRASSSPGRGGSSEPGSPRSAYSSDDSGCEGALSPAEREL
LDFSSWLGGY
Download sequence
Identical sequences ENSGGOP00000007261 ENSGGOP00000007261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]