SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007293 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000007293
Domain Number - Region: 57-145
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 0.0615
Family C-terminal domain of PLC-beta 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007293   Gene: ENSGGOG00000007454   Transcript: ENSGGOT00000007486
Sequence length 153
Comment pep:known_by_projection chromosome:gorGor3.1:5:26181582:26182043:1 gene:ENSGGOG00000007454 transcript:ENSGGOT00000007486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPLYQAGSILMTVNTLQGKKMVESGLQSGDFSLSQSWPSCLPPPADLEILQQKVAGVQR
ELEDFKKEALKSIHYLEDAFCEMNGALVQQEEQAARVRQRLREEEDRGIVRNKVLTFLLP
REKQLREHCKRLEDLLLDRGRDALRATKKSQAD
Download sequence
Identical sequences G3QWW9
XP_008968845.1.60992 XP_018882129.1.27298 ENSGGOP00000007293 ENSGGOP00000007293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]